CD55 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD55 |
CD55 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD55 |
CD46 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD46 |
Rabbit anti-MBL2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MBL2 |
CD59 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD59 |
Rabbit anti-CFB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CFB |
Rabbit anti-KNG1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KNG1 |
FGB Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FGB |
Rabbit Polyclonal F12 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human F12 protein (between residues 50-150) [UniProt P00748] |
Rabbit anti-PROC Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PROC |
Rabbit anti-SERPING1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SERPING1 |
Rabbit polyclonal antibody to Factor XIIIa (coagulation factor XIII, A1 polypeptide)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 258 of Factor XIIIa (Uniprot ID#P00488) |
Anti-F13A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human coagulation factor XIII, A1 polypeptide |
Rabbit anti-F9 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human F9 |
Rabbit anti-KLKB1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KLKB1 |
Rabbit polyclonal antibody to Factor IX (coagulation factor IX)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 217 and 453 of Factor IX (Uniprot ID#P00740) |
Rabbit polyclonal anti-uPAR antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 51 of rat uPAR |
Anti-BDKRB2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2 |
A2M Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human A2M |
Rabbit anti-SERPINC1 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SERPINC1 |
Rabbit anti-TFPI Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TFPI |
Rabbit Polyclonal Serpin E1/PAI-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 300-400) [UniProt P05121] |
Rabbit Polyclonal Anti-F2 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR |
Rabbit Polyclonal Anti-THRB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB |
Rabbit polyclonal FA10 (activated heavy chain, Cleaved-Ile235) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human FA10. |
Rabbit polyclonal anti-C6 (complement component 6) antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human C6. |
Anti-PLAT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue |
Rabbit polyclonal C1QC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human C1QC. |
Rabbit Polyclonal TFPI Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TFPI antibody was raised against a 13 amino acid peptide near the amino terminus of human TFPI. |
Rabbit anti-SERPINA1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SERPINA1 |
Rabbit Polyclonal Anti-B2 Bradykinin Receptor
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide GKRFRKKSWEVYQG(C), corresponding to amino acid residues 336-349 of human BKRB2. Intracellular, C-terminus. |
Rabbit polyclonal Anti-Pros1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pros1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS |
Rabbit Polyclonal Anti-Klkb1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Klkb1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSK |
Rabbit polyclonal PLMN (heavy chain A short form, Cleaved-Val98) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PLMN. |
Rabbit polyclonal anti-CFD (Adipsin) antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 232 of mouse Adipsin |
Anti-KNG1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human kininogen 1 |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) SERPINC1 mouse monoclonal antibody, clone OTI8D5 (formerly 8D5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) FGG mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI6F5 (formerly 6F5)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI9E2 (formerly 9E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI3G12 (formerly 3G12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI9E8 (formerly 9E8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F13A1 mouse monoclonal antibody, clone OTI8E2 (formerly 8E2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |