Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Goat Polyclonal Anti-CDH1 (aa662-675) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDH1 (aa662-675) Antibody: Peptide with sequence C-DYKINLKLMDNQNK, from the internal region of the protein sequence according to NP_004351.1. |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
Active filters
Applications
- WB
Pathways
- Endometrial cancer
Filter by
Target Symbol
- TP53 (243)
- MAP2K1 (222)
- EGFR (156)
- ERBB2 (153)
- CTNNB1 (149)
- AKT1 (116)
- BRAF (92)
- MLH1 (77)
- MAPK1 (68)
- PIK3CG (63)
- CDH1 (58)
- KRAS (58)
- MYC (50)
- PIK3R5 (46)
- HRAS (45)
- AKT2 (39)
- CCND1 (35)
- MAP2K2 (33)
- FOXO3 (32)
- PIK3CD (29)
- RAF1 (29)
- EGF (24)
- ARAF (23)
- CASP9 (23)
- MAPK3 (22)
- AKT3 (17)
- BAD (17)
- GSK3B (17)
- NRAS (16)
- PTEN (15)
- APC (11)
- PIK3R1 (11)
- GRB2 (10)
- ILK (10)
- LEF1 (10)
- CTNNA1 (9)
- ELK1 (9)
- TCF7 (8)
- PDPK1 (7)
- PIK3CA (4)
- PIK3R3 (4)
- TCF7L2 (4)
- APC2 (3)
- AXIN1 (3)
- AXIN2 (3)
- PIK3CB (3)
- SOS2 (3)
- TCF7L1 (3)
- B RAF (2)
- CASPASE 9 (2)
- PIK3R2 (2)
- SOS1 (2)
- CTNNA2 (1)
- CTNNA3 (1)
Reactivities
- Human (1898)
- Mouse (1554)
- Rat (1491)
- Monkey (501)
- Dog (418)
- Bovine (19)
- Chicken (16)
- Pig (13)
- Xenopus (10)
- Canine (9)
- Rabbit (6)
- Cow (5)
- Drosophila (4)
- Hamster (4)
- Zebrafish (4)
- Primate (3)
- Canis (2)
- Chimpanzee (2)
- Rhesus Monkey (2)
- Sheep (2)
- Yeast (2)
- Feline (1)
- Gerbil (1)
- Guinea Pig (1)
- X. tropicalis (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (2088)
- Protein Kinase (1006)
- ES Cell Differentiation/IPS (668)
- Transcription Factors (508)
- Transmembrane (391)
- Stem cell - Pluripotency (353)
- Stem cell relevant signaling - JAK/STAT signaling pathway (241)
- Adult stem cells (190)
- Cancer stem cells (156)
- Secreted Protein (156)
- Stem cell relevant signaling - Wnt Signaling pathway (88)
- Induced pluripotent stem cells (77)
- Embryonic stem cells (74)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (50)
- Stem cell relevant signaling - DSL/Notch pathway (35)
- Protease (25)
- Phosphatase (15)