Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Antibody against SLC29A1 (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 234-263 amino acids from the Central region of human ENT1. |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PRDX1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX1 antibody: synthetic peptide directed towards the N terminal of human PRDX1. Synthetic peptide located within the following region: SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Betatrophin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Betatrophin antibody was raised against a 16 amino acid peptide near the amino terminus of human Betatrophin. The immunogen is located within amino acids 40 - 90 of Betatrophin. |
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Anti-SAA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 19-122 amino acids of human serum amyloid A1 |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
XRCC2 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human XRCC2 |
Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY |
Rabbit Polyclonal Anti-MBP(myelin basic protein) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBP(myelin basic protein) Antibody: Peptide sequence around aa.291~295(G-G-R-D-S |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Anti-Potassium Chloride Cotransporter (KCC2) (Ser940) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser940 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Active filters
Category
- Antibodies
Reactivities
- Rat
Conjugates
- Unconjugated
Citations
- Yes
Filter by
Target Symbol
- GAPDH (12)
- ACTB (7)
- LGR5 (7)
- VIM (7)
- CANX (6)
- CDH2 (6)
- GBE1 (6)
- MAPK8 (6)
- ALK (5)
- CTNNB1 (5)
- KRT8 (5)
- MAPK1 (5)
- MME (5)
- MMP2 (5)
- NCAM1 (5)
- SNAI1 (5)
- SOX17 (5)
- ZEB1 (5)
- ALDH1A3 (4)
- ARNTL (4)
- BAX (4)
- BECN1 (4)
- CD4 (4)
- CDX2 (4)
- DPP9 (4)
- GATA4 (4)
- HSPA1A (4)
- KEAP1 (4)
- LOXL2 (4)
- LTA4H (4)
- NIT2 (4)
- NR4A3 (4)
- PDE10A (4)
- POSTN (4)
- PRRX1 (4)
- SAMHD1 (4)
- SLC7A8 (4)
- SNAI2 (4)
- SQSTM1 (4)
- UNG (4)
- ALDH1L1 (3)
- BCL2 (3)
- EPAS1 (3)
- ERBB2 (3)
- HNRNPM (3)
- HSP90AA1 (3)
- HSPD1 (3)
- IGF1R (3)
- JAK2 (3)
- KRT18 (3)
- LIMK1 (3)
- MAPK3 (3)
- NTRK2 (3)
- PARP1 (3)
- PPARGC1A (3)
- PPP4C (3)
- PRKAR1A (3)
- RAC1 (3)
- RELA (3)
- SLC18A2 (3)
- STAT3 (3)
- TGFBR2 (3)
- TMEM100 (3)
- TP63 (3)
- TUBB (3)
- ABCC4 (2)
- ABCD1 (2)
- ABCG2 (2)
- ACAA2 (2)
- ACTA2 (2)
- ACTN1 (2)
- ADH1B (2)
- ADH5 (2)
- AFG3L2 (2)
- AKT1 (2)
- AKT3 (2)
- ALDH2 (2)
- ANXA1 (2)
- ANXA3 (2)
- AOX1 (2)
- APMAP (2)
- APPL1 (2)
- AQP1 (2)
- ARNT (2)
- B3GNT2 (2)
- BAG3 (2)
- BCL2L1 (2)
- BDNF (2)
- BMP4 (2)
- BRAF (2)
- BSG (2)
- BTK (2)
- CAT (2)
- CCNA2 (2)
- CCND1 (2)
- CD36 (2)
- CD63 (2)
- CDK2 (2)
- CDK5 (2)
- CHMP4C (2)
Applications
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (674)
- Transmembrane (243)
- Transcription Factors (155)
- ES Cell Differentiation/IPS (130)
- Protein Kinase (92)
- Secreted Protein (73)
- Protease (56)
- Stem cell - Pluripotency (46)
- Adult stem cells (27)
- Embryonic stem cells (23)
- GPCR (22)
- Induced pluripotent stem cells (20)
- Cancer stem cells (11)
- Phosphatase (10)
- Nuclear Hormone Receptor (9)
- Ion Channels: Other (8)
- P450 (8)
- Stem cell relevant signaling - DSL/Notch pathway (8)
- Stem cell relevant signaling - JAK/STAT signaling pathway (8)
- Ion Channels: Transient receptor potential (4)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (4)
- Stem cell relevant signaling - Wnt Signaling pathway (4)
- Ion Channels: Glutamate Receptors (3)
- Ion Channels: ATP Receptors (2)
- Ion Channels: Potassium (1)
Pathways
- Pathways in cancer (138)
- Metabolic pathways (112)
- Focal adhesion (88)
- MAPK signaling pathway (76)
- Colorectal cancer (59)
- Regulation of actin cytoskeleton (58)
- Neurotrophin signaling pathway (56)
- Prostate cancer (55)
- Adherens junction (54)
- Pancreatic cancer (54)
- Chemokine signaling pathway (44)
- Alzheimer's disease (43)
- Progesterone-mediated oocyte maturation (43)
- Renal cell carcinoma (43)
- Insulin signaling pathway (42)
- Chronic myeloid leukemia (41)
- ErbB signaling pathway (41)
- Toll-like receptor signaling pathway (38)
- Endocytosis (36)
- Leukocyte transendothelial migration (35)
- Small cell lung cancer (35)
- Axon guidance (33)
- Endometrial cancer (33)
- Wnt signaling pathway (33)
- Acute myeloid leukemia (32)
- Adipocytokine signaling pathway (32)
- Apoptosis (32)
- Melanoma (32)
- T cell receptor signaling pathway (32)
- Glioma (31)
- Bladder cancer (30)
- Fc epsilon RI signaling pathway (30)
- Pathogenic Escherichia coli infection (30)
- VEGF signaling pathway (30)
- B cell receptor signaling pathway (29)
- Glycolysis / Gluconeogenesis (29)
- Natural killer cell mediated cytotoxicity (29)
- Cell adhesion molecules (CAMs) (28)
- Tight junction (28)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (27)
- Fc gamma R-mediated phagocytosis (27)
- Gap junction (27)
- NOD-like receptor signaling pathway (27)
- Prion diseases (27)
- Jak-STAT signaling pathway (26)
- Non-small cell lung cancer (26)
- GnRH signaling pathway (25)
- Huntington's disease (25)
- Type II diabetes mellitus (25)
- Amyotrophic lateral sclerosis (ALS) (23)
- Antigen processing and presentation (23)
- TGF-beta signaling pathway (23)
- Thyroid cancer (23)
- Viral myocarditis (23)
- Cytokine-cytokine receptor interaction (21)
- Epithelial cell signaling in Helicobacter pylori infection (21)
- p53 signaling pathway (21)
- Purine metabolism (20)
- RIG-I-like receptor signaling pathway (20)
- Cell cycle (19)
- Dilated cardiomyopathy (19)
- ECM-receptor interaction (19)
- Vascular smooth muscle contraction (19)
- Hematopoietic cell lineage (18)
- Hypertrophic cardiomyopathy (HCM) (18)
- Long-term depression (18)
- Melanogenesis (18)
- mTOR signaling pathway (18)
- Neuroactive ligand-receptor interaction (17)
- Drug metabolism - cytochrome P450 (16)
- Long-term potentiation (16)
- Oocyte meiosis (16)
- Ubiquitin mediated proteolysis (16)
- Calcium signaling pathway (15)
- Dorso-ventral axis formation (15)
- Parkinson's disease (14)
- Base excision repair (12)
- Lysosome (12)
- Metabolism of xenobiotics by cytochrome P450 (12)
- Tyrosine metabolism (12)
- Vibrio cholerae infection (12)
- Starch and sucrose metabolism (11)
- Type I diabetes mellitus (11)
- ABC transporters (10)
- Arachidonic acid metabolism (10)
- Arginine and proline metabolism (10)
- Basal cell carcinoma (10)
- Citrate cycle (TCA cycle) (10)
- Cytosolic DNA-sensing pathway (10)
- Primary immunodeficiency (10)
- Retinol metabolism (10)
- Spliceosome (10)
- Fatty acid metabolism (8)
- Histidine metabolism (8)
- Pyrimidine metabolism (8)
- Tryptophan metabolism (8)
- Alanine (7)
- RNA degradation (7)
- Regulation of autophagy (7)
- Valine (7)
- aspartate and glutamate metabolism (7)
- leucine and isoleucine degradation (7)
- Cardiac muscle contraction (6)
- Fructose and mannose metabolism (6)
- Porphyrin and chlorophyll metabolism (6)
- Renin-angiotensin system (6)
- Systemic lupus erythematosus (6)
- beta-Alanine metabolism (6)
- Allograft rejection (5)
- Galactose metabolism (5)
- Glutathione metabolism (5)
- Graft-versus-host disease (5)
- Inositol phosphate metabolism (5)
- Maturity onset diabetes of the young (5)
- One carbon pool by folate (5)
- Oxidative phosphorylation (5)
- Phosphatidylinositol signaling system (5)
- Androgen and estrogen metabolism (4)
- Ascorbate and aldarate metabolism (4)
- Autoimmune thyroid disease (4)
- Butanoate metabolism (4)
- Circadian rhythm - mammal (4)
- DNA replication (4)
- Drug metabolism - other enzymes (4)
- Fatty acid elongation in mitochondria (4)
- Hedgehog signaling pathway (4)
- Methane metabolism (4)
- Mismatch repair (4)
- Notch signaling pathway (4)
- Nucleotide excision repair (4)
- Phenylalanine metabolism (4)
- Proteasome (4)
- Sphingolipid metabolism (4)
- Amino sugar and nucleotide sugar metabolism (3)
- Cysteine and methionine metabolism (3)
- Glycerolipid metabolism (3)
- Homologous recombination (3)
- PPAR signaling pathway (3)
- Pentose phosphate pathway (3)
- Propanoate metabolism (3)
- SNARE interactions in vesicular transport (3)
- Selenoamino acid metabolism (3)
- Caffeine metabolism (2)
- Complement and coagulation cascades (2)
- Glycerophospholipid metabolism (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Keratan sulfate biosynthesis (2)
- Limonene and pinene degradation (2)
- Lysine degradation (2)
- Nicotinate and nicotinamide metabolism (2)
- Nitrogen metabolism (2)
- Other glycan degradation (2)
- Pantothenate and CoA biosynthesis (2)
- Pentose and glucuronate interconversions (2)
- Primary bile acid biosynthesis (2)
- Pyruvate metabolism (2)
- Taurine and hypotaurine metabolism (2)
- Vitamin B6 metabolism (2)
- Asthma (1)
- Ether lipid metabolism (1)
- Folate biosynthesis (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Heparan sulfate biosynthesis (1)
- Linoleic acid metabolism (1)
- N-Glycan biosynthesis (1)
- Ribosome (1)