Germany
Japan
United Kingdom
China
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
Download
.jpg?d=110x100 "User supplied image")
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3C2-4
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3G11-14
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 4A5-19
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5F4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5G12-21
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6F5-23
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6H8-22
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8E8-2
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8F6-6
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 9G5-20
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 12G4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 15C4-8
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 16F12-11
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NEK11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEK11 antibody: synthetic peptide directed towards the middle region of human NEK11. Synthetic peptide located within the following region: KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS |
Active filters
Category
- Antibodies
Families
- Protein Kinase
Filter by
Target Symbol
- ALK (279)
- ERBB2 (239)
- MAP2K1 (237)
- EGFR (207)
- MAP2K3 (158)
- AKT1 (127)
- BRAF (100)
- MAPK13 (99)
- KIT (93)
- MAPK1 (74)
- ERBB3 (73)
- MTOR (72)
- BTK (71)
- FGFR2 (66)
- LIMK1 (64)
- MET (64)
- PRKCE (64)
- CDK2 (63)
- PDGFRA (63)
- BUB1B (62)
- CHEK2 (61)
- RET (61)
- MAPK7 (57)
- RIPK3 (57)
- MAPKAPK5 (56)
- MAPK8 (55)
- RPS6KB1 (54)
- KDR (53)
- PLK1 (52)
- PDGFRB (50)
- CSNK1G2 (48)
- CSNK1G1 (47)
- MARK3 (47)
- TYRO3 (47)
- NRBP1 (45)
- AKT2 (44)
- RPS6KA2 (44)
- FGFR1 (43)
- PRKD2 (42)
- TLK2 (42)
- TRIM24 (42)
- MAPK14 (41)
- POMK (41)
- PTK2 (41)
- PIM2 (39)
- MAP2K4 (38)
- PRKY (37)
- STK39 (37)
- PLK4 (36)
- TRIB3 (36)
- JAK2 (35)
- RIPK1 (35)
- TRIM28 (35)
- CDKL2 (34)
- FRK (34)
- HIPK1 (34)
- MAP2K2 (34)
- ROR2 (34)
- CDKL1 (33)
- ERBB4 (33)
- MAK (33)
- RAF1 (33)
- CDK15 (32)
- TWF1 (32)
- MAPK9 (31)
- ROS1 (31)
- DAPK2 (30)
- SRC (30)
- STK11 (30)
- CAMK2B (29)
- IGF1R (29)
- IKBKE (28)
- FLT4 (27)
- IRAK2 (27)
- PRKCA (27)
- TP53RK (27)
- CHEK1 (26)
- CHUK (26)
- PAK1 (26)
- MAP3K8 (25)
- ARAF (24)
- CSNK1E (24)
- FLT1 (24)
- MOK (24)
- NTRK3 (24)
- CDK1 (23)
- CSF1R (23)
- MAPK3 (23)
- PRKAA1 (23)
- SCYL3 (23)
- LCK (22)
- MAST2 (22)
- NEK6 (22)
- NTRK2 (22)
- PAK4 (22)
- RIOK2 (22)
- ABL1 (21)
- AURKC (21)
- GSK3B (20)
- IKBKB (20)
Reactivities
- Human (6550)
- Mouse (5157)
- Rat (4779)
- Dog (685)
- Monkey (589)
- Bovine (74)
- Chicken (43)
- Cow (37)
- Pig (35)
- Xenopus (21)
- Primate (15)
- Rabbit (15)
- Hamster (12)
- Canine (11)
- Canis (8)
- Horse (7)
- Rhesus Monkey (7)
- Bat (6)
- X. tropicalis (6)
- Zebrafish (6)
- Chimpanzee (4)
- Drosophila (4)
- Frog (4)
- Fish (3)
- Gibbon (3)
- Gorilla (3)
- Porcine (3)
- Guinea Pig (2)
- Invertebrate (2)
- Mammalian (2)
- Orang-Utan (2)
- Sheep (2)
- C. elegans (1)
- Tobacco hornworm (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (2236)
- MAPK signaling pathway (2204)
- ErbB signaling pathway (1828)
- Focal adhesion (1791)
- Prostate cancer (1624)
- Neurotrophin signaling pathway (1410)
- Pancreatic cancer (1347)
- GnRH signaling pathway (1312)
- Fc epsilon RI signaling pathway (1300)
- Colorectal cancer (1259)
- Glioma (1250)
- Non-small cell lung cancer (1237)
- Progesterone-mediated oocyte maturation (1225)
- Regulation of actin cytoskeleton (1208)
- Toll-like receptor signaling pathway (1207)
- Endometrial cancer (1203)
- Melanoma (1192)
- Insulin signaling pathway (1103)
- Acute myeloid leukemia (1056)
- T cell receptor signaling pathway (1056)
- Bladder cancer (1047)
- Chemokine signaling pathway (1037)
- Endocytosis (965)
- Gap junction (937)
- VEGF signaling pathway (930)
- Fc gamma R-mediated phagocytosis (877)
- Renal cell carcinoma (853)
- Chronic myeloid leukemia (850)
- Calcium signaling pathway (825)
- Adherens junction (813)
- B cell receptor signaling pathway (765)
- Vascular smooth muscle contraction (745)
- Long-term potentiation (710)
- Cytokine-cytokine receptor interaction (707)
- Oocyte meiosis (704)
- Epithelial cell signaling in Helicobacter pylori infection (693)
- Natural killer cell mediated cytotoxicity (677)
- mTOR signaling pathway (669)
- Long-term depression (637)
- Melanogenesis (625)
- Thyroid cancer (549)
- Dorso-ventral axis formation (541)
- Axon guidance (537)
- Adipocytokine signaling pathway (526)
- Cell cycle (441)
- NOD-like receptor signaling pathway (429)
- Tight junction (402)
- Prion diseases (398)
- RIG-I-like receptor signaling pathway (397)
- Type II diabetes mellitus (394)
- Apoptosis (376)
- Small cell lung cancer (359)
- Amyotrophic lateral sclerosis (ALS) (344)
- Wnt signaling pathway (341)
- TGF-beta signaling pathway (285)
- Leukocyte transendothelial migration (278)
- Jak-STAT signaling pathway (268)
- p53 signaling pathway (212)
- Hedgehog signaling pathway (174)
- Cytosolic DNA-sensing pathway (172)
- Alzheimer's disease (148)
- Hematopoietic cell lineage (133)
- Primary immunodeficiency (125)
- Olfactory transduction (102)
- Pathogenic Escherichia coli infection (82)
- Vibrio cholerae infection (63)
- Regulation of autophagy (51)
- Phosphatidylinositol signaling system (45)
- Viral myocarditis (34)
- Hypertrophic cardiomyopathy (HCM) (31)
- Circadian rhythm - mammal (27)
- Parkinson's disease (25)
- Basal cell carcinoma (22)
- PPAR signaling pathway (20)
- Dilated cardiomyopathy (18)
- Taste transduction (18)
- Ubiquitin mediated proteolysis (18)
- Non-homologous end-joining (17)
- Purine metabolism (13)
- Nucleotide excision repair (11)
- Basal transcription factors (5)