Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY |
Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TSG101 Antibody is: synthetic peptide directed towards the N-terminal region of Human TSG101. Synthetic peptide located within the following region: YKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYR |
Rabbit Polyclonal Anti-ZFYVE20 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFYVE20 antibody: synthetic peptide directed towards the N terminal of human ZFYVE20. Synthetic peptide located within the following region: MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKS |
Rabbit Polyclonal Antibody against MDM2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Rabbit polyclonal anti-TSG101 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TS101. |
Anti-PARD6A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 334-346 amino acids of human par-6 partitioning defective 6 homolog alpha (C. elegans) |
PARD6A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human paxillin |
Rabbit Polyclonal Anti-SNF8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNF8 antibody: synthetic peptide directed towards the middle region of human SNF8. Synthetic peptide located within the following region: DHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQA |
Rabbit Polyclonal Anti-SNF8 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNF8 antibody: synthetic peptide directed towards the C terminal of human SNF8. Synthetic peptide located within the following region: QVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP |
Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CBL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL |
Rabbit Polyclonal CBL (Tyr674) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL around the phosphorylation site of Tyrosine 674 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MDM2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MDM2 |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MDM2 around the phosphorylation site of Serine 166 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166. |
| Modifications | Phospho-specific |
Rabbit Polyclonal ITCH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ITCH antibody was raised against a 15 amino acid peptide near the amino terminus of human ITCH |
Rabbit Polyclonal anti-EAP30 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30. Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF |
Rabbit Polyclonal Anti-WWP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WWP1 antibody: synthetic peptide directed towards the N terminal of human WWP1. Synthetic peptide located within the following region: ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT |
CBL rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthesized non-phosphopeptide derived from human c-Cbl around the phosphorylation site of tyrosine 700 (T-E-YP-M-T) |
CBL rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthesized non-phosphopeptide derived from human c-Cbl around the phosphorylation site of tyrosine 700 (T-E-YP-M-T) |
Goat Polyclonal Antibody against ITCH / AIF4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EIKSHDLKPNGGN, from the internal region of the protein sequence according to NP_113671.3. |
Goat Polyclonal Antibody against MDM2 (isoform)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DELSGERQRKRHKSD, from the internal region of the protein sequence according to NP_002383.2. |
Goat Polyclonal Antibody against ZFYVE20
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ELKHTLAKQKGGTD, from the C Terminus of the protein sequence according to NP_071735. |
Rabbit polyclonal anti-ZFYVE20 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZFYVE20. |
Rabbit Polyclonal MDM2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2. |
Rabbit Polyclonal anti-PARD6A antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARD6A antibody: synthetic peptide directed towards the N terminal of human PARD6A. Synthetic peptide located within the following region: MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH |
Rabbit Polyclonal Anti-ITCH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITCH antibody: synthetic peptide directed towards the N terminal of human ITCH. Synthetic peptide located within the following region: QLESEVVTNGETTCSESASQNDDGSRSKDETRVSTNGSDDPEDAGAGENR |
Rabbit Polyclonal Anti-VPS25 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vps25 antibody is: synthetic peptide directed towards the C-terminal region of Rat Vps25. Synthetic peptide located within the following region: LYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
