Germany
Japan
United Kingdom
China
Antibodies
Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 379.00
In Stock
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
USD 379.00
In Stock
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926) |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the N terminal of human FAH. Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT |
USD 379.00
In Stock
Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
USD 379.00
In Stock
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Pathways
- Metabolic pathways
Filter by
Target Symbol
- NME1 (167)
- OTC (127)
- PIK3C2A (111)
- PNMT (87)
- TYMS (85)
- LTA4H (66)
- ABAT (60)
- SMS (59)
- RRM1 (56)
- ACAT2 (55)
- ACY1 (53)
- PFKP (52)
- AKR1A1 (51)
- ATP6V1C2 (51)
- HADH (51)
- NDUFA7 (51)
- PGAM2 (51)
- PPAT (51)
- RPN1 (51)
- ACSS2 (50)
- AK4 (49)
- GAPDH (48)
- GCH1 (48)
- TH (48)
- AK5 (47)
- ASS1 (47)
- CMPK1 (46)
- UCK1 (46)
- ALOX5 (45)
- NANP (45)
- PYCR2 (45)
- ACAA2 (42)
- ARG1 (42)
- AMDHD1 (40)
- GRHPR (40)
- PKLR (40)
- UPRT (39)
- DLD (37)
- AK1 (35)
- GBE1 (35)
- PAFAH1B3 (35)
- PISD (35)
- GBA (34)
- NDUFB9 (33)
- SHMT2 (32)
- POLR2H (31)
- GPI (30)
- HMBS (30)
- MMAB (30)
- PAPSS2 (30)
- SDHB (30)
- ADH5 (28)
- HAO1 (28)
- MTHFR (27)
- NNMT (27)
- CYP2A6 (26)
- GSS (26)
- HSD17B10 (26)
- IDH1 (25)
- LDHA (25)
- ACO2 (24)
- ALDOB (24)
- BHMT (23)
- GAD1 (23)
- PIKFYVE (23)
- ATP6V1B1 (22)
- COX17 (22)
- UQCRC1 (22)
- NDUFA4L2 (21)
- NFKB1 (21)
- PAICS (21)
- SCP2 (21)
- TALDO1 (21)
- ALDH1A3 (20)
- DDOST (20)
- MTMR2 (20)
- OXSM (20)
- PNPO (20)
- TDO2 (20)
- ATIC (19)
- CAT (19)
- PRDX6 (19)
- ENO2 (18)
- FH (18)
- HSD17B4 (18)
- POLR2A (18)
- ACSM5 (17)
- GLS2 (17)
- HPRT1 (17)
- PDHA1 (17)
- ACADM (16)
- ADH7 (16)
- ASL (16)
- B3GNT2 (16)
- BDH2 (16)
- IDH3A (16)
- IVD (16)
- PHGDH (16)
- POLR2E (16)
- UPP2 (16)