Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Polyclonal TACE Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid. |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit anti-FADD Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FADD |
Rabbit Polyclonal Anti-SDHB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |
Goat Anti-CACNA1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Phospho-NOS3-S1177 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S1177 of human NOS3 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
Chicken Polyclonal Anti-GAPDH Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GAPDH antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human GAPDH. The immunogen is located within amino acids 230 - 280 of GAPDH. |
Rabbit polyclonal CDK5 (Ab-15) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDK5 around the phosphorylation site of tyrosine 15 (G-T-YP-G-T) |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2] |
Rabbit Polyclonal Anti-LRP1 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRP1 antibody: synthetic peptide directed towards the middle region of human LRP1. Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR |
Goat Polyclonal Antibody against APOE
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-VGTSAAPVPSDNH, from the C Terminus of the protein sequence according to NP_000032.1. |
Goat Anti-ERN1 / IRE1a Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PNAHGKIKAMISD, from the internal region of the protein sequence according to NP_001424.3. |
Active filters
Clonalities
- Polyclonal
Pathways
- Alzheimer's disease
Filter by
Category
Target Symbol
- MAPT (43)
- GAPDH (28)
- APP (25)
- CASP9 (25)
- SNCA (25)
- CASP3 (23)
- NOS3 (23)
- BAD (20)
- GRIN1 (19)
- GSK3B (18)
- CASP8 (17)
- GRIN2B (16)
- MAPK3 (15)
- MAPK1 (14)
- CASP7 (13)
- TNF (12)
- CDK5 (11)
- FAS (11)
- IL1B (11)
- NOS2 (11)
- TNFRSF1A (11)
- APAF1 (10)
- COX4I1 (10)
- HSD17B10 (9)
- APOE (8)
- ATF6 (8)
- CYCS (8)
- GRIN2A (8)
- MME (8)
- NOS1 (8)
- PPP3CA (8)
- ADAM17 (7)
- PSEN1 (7)
- BACE1 (6)
- BACE2 (6)
- BID (6)
- CAPN1 (6)
- EIF2AK3 (6)
- ERN1 (6)
- IDE (6)
- NDUFS1 (6)
- NDUFV2 (6)
- ADAM10 (5)
- CACNA1C (5)
- COX6B1 (5)
- NAE1 (5)
- NDUFA8 (5)
- NDUFA9 (5)
- NDUFS8 (5)
- PSENEN (5)
- SDHB (5)
- ATP5F1A (4)
- ATP5F1D (4)
- ATP5PF (4)
- COX5B (4)
- FADD (4)
- GRIN2C (4)
- LRP1 (4)
- NCSTN (4)
- NDUFA10 (4)
- NDUFA4 (4)
- NDUFB10 (4)
- NDUFB9 (4)
- NDUFS2 (4)
- NDUFS3 (4)
- NDUFS4 (4)
- PLCB3 (4)
- PPP3CB (4)
- SDHA (4)
- APBB1 (3)
- APH1A (3)
- ATP2A1 (3)
- ATP2A2 (3)
- ATP5F1B (3)
- ATP5PB (3)
- ATP5PD (3)
- CALM3 (3)
- CHP1 (3)
- COX4I2 (3)
- COX5A (3)
- COX6A2 (3)
- COX7A1 (3)
- COX7A2 (3)
- COX7B (3)
- CYC1 (3)
- GRIN2D (3)
- NDUFA3 (3)
- NDUFC2 (3)
- NDUFS5 (3)
- NDUFS6 (3)
- NDUFS7 (3)
- NDUFV1 (3)
- PLCB1 (3)
- PPP3CC (3)
- UQCRFS1 (3)
- ATP2A3 (2)
- ATP5F1C (2)
- ATP5MC1 (2)
- ATP5MC2 (2)
- CALM2 (2)
Reactivities
- Human (635)
- Mouse (462)
- Rat (398)
- Dog (24)
- Bovine (23)
- Monkey (18)
- Pig (17)
- Cow (15)
- Rabbit (15)
- Chimpanzee (11)
- Chicken (10)
- Canine (9)
- Xenopus (7)
- Rhesus Monkey (6)
- Gerbil (4)
- Primate (4)
- Zebrafish (4)
- Drosophila (3)
- Feline (3)
- X. tropicalis (3)
- Canis (2)
- Avian (1)
- Eukaryote (1)
- Hamster (1)
- Invertebrate (1)
- Macaque (1)
- Porcine (1)
- Protozoa (1)
- Sheep (1)
- Yeast (1)
Applications
Antibody Hosts
Conjugates
Modifications
Families
- Druggable Genome (604)
- Transmembrane (236)
- Protease (137)
- ES Cell Differentiation/IPS (80)
- Protein Kinase (70)
- Secreted Protein (59)
- Ion Channels: Glutamate Receptors (50)
- Transcription Factors (38)
- Stem cell - Pluripotency (33)
- Phosphatase (17)
- Adult stem cells (8)
- Ion Channels: Sodium (8)
- Ion Channels: Calcium (7)