Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 415.00
2 Weeks
Rabbit Polyclonal antibody to HSD17B4 (hydroxysteroid (17-beta) dehydrogenase 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 18 and 261 of HSD17B4 (Uniprot ID#P51659) |
Rabbit Polyclonal Anti-AMACR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AMACR antibody: synthetic peptide directed towards the C terminal of human AMACR. Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP |
Rabbit polyclonal antibody to HSD3a (aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 217 of HSD3a (Uniprot ID#P17516) |
USD 415.00
5 Days
Rabbit Polyclonal antibody to HSD17B4 (hydroxysteroid (17-beta) dehydrogenase 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 355 and 645 of HSD17B4 (Uniprot ID#P51659) |
Rabbit polyclonal Cytochrome P450 7B1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 7B1. |
Rabbit polyclonal Cytochrome P450 27A1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 27A1. |
Rabbit polyclonal anti-CYP39A1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CYP39A1. |
Rabbit polyclonal CYP8B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
CYP7B1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human |
| Immunogen | Peptide with sequence C-YPDSDVLFRYKVKS, from the C Terminus of the protein sequence according to NP_004811.1. |
USD 450.00
2 Weeks
Goat Polyclonal Antibody against AKR1C4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DPKYQRVELNDGH-C, from the N Terminus of the protein sequence according to NP_001809.2. |
Rabbit Polyclonal Anti-CYP46A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CYP46A1 Antibody: synthetic peptide directed towards the C terminal of human CYP46A1. Synthetic peptide located within the following region: YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM |
Rabbit Polyclonal Anti-CYP7B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP7B1 antibody: synthetic peptide directed towards the C terminal of human CYP7B1. Synthetic peptide located within the following region: AMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLE |
CYP7B1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP7B1 |
AKR1C4 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 10-39 amino acids from the N-terminal region of human AKR1C4. |
AKR1D1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 110-139 amino acids from the Central region of human AKR1D1 |
Rabbit anti-AMACR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AMACR |
Goat Anti-AMACR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLNSDKIIESN, from the C Terminus of the protein sequence according to NP_055139.4; NP_001161067.1 |
Goat Anti-AMACR (aa312-326) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RGSFITSEEQDVSPR, from the internal region of the protein sequence according to NP_055139.4; NP_001161067.1 |
Rabbit Polyclonal Anti-CYP27A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP27A1 antibody: synthetic peptide directed towards the middle region of human CYP27A1 |
Rabbit Polyclonal Anti-CYP8B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP8B1 antibody: synthetic peptide directed towards the middle region of human CYP8B1. Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP |
Rabbit Polyclonal Anti-AKR1D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1D1 antibody: synthetic peptide directed towards the middle region of human AKR1D1. Synthetic peptide located within the following region: YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL |
Rabbit anti AMACR Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) HSD17B4 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI4G5 (formerly 4G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Families
- Druggable Genome
Pathways
- Primary bile acid biosynthesis