GABRA2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABRA2 |
GABRA2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABRA2 |
Rabbit Polyclonal Anti-GABRA5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
Rabbit polyclonal anti-GLRB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLRB. |
Rabbit anti-GLRA1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human GLRA1 |
Rabbit anti-GABRB2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABRB2 |
Rabbit anti-GABRR1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABRR1 |
Rabbit Polyclonal Anti-GABRG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GABRG2 antibody is: synthetic peptide directed towards the N-terminal region of Human GABRG2. Synthetic peptide located within the following region: VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINME |
Rabbit Polyclonal Anti-GABRG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRG1 Antibody: A synthesized peptide derived from human GABRG1 |
GABA A Receptor beta 3 (GABRB3) (400-411) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Canine, Equine, Hamster, Human, Monkey, Mouse, Rat |
Immunogen | Synthetic peptide from an internal region of human GABRB3 (NP_000805.1; NP_068712.1) |
GABA A Receptor alpha 4 (GABRA4) (349-361) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human GABRA4 (NP_000800.2) |
Rabbit polyclonal antibody to alpha 2 Glycine Receptor (glycine receptor, alpha 2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 216 of Glycine Receptor alpha 2 (Uniprot ID#P23416) |
Rabbit polyclonal anti-GABRA4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GABRA4. |
Rabbit polyclonal GABRA2 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2. |
Rabbit Polyclonal GABA-RB (Ser434) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GABA-RB around the phosphorylation site of Serine 434 |
Modifications | Phospho-specific |
Rabbit Polyclonal GABA-RB Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GABA-RB |
Rabbit Polyclonal Anti-GABA (A) alpha3 Receptor (extracellular)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide QGESRRQEPGDFVKQ(C), corresponding to amino acid residues 29-43 of human GABA (A) a3 Receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-GABRP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
GABA A Receptor beta 3 (GABRB3) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Immunogen | Peptide with sequence C-EKTAKAKNDRSK, from the internal region of the protein sequence according to NP_000805.1; NP_068712.1. |
GABA A Receptor gamma 2 (GABRG2) (400-410) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_944494.1; NP_000807.2; NP_944493.2. |
GABA A Receptor beta 1 (GABRB1) (1-226) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 226 of Human GABA A Receptor beta 1 |
USD 410.00
5 Days
Mouse Monoclonal Anti-GABA(A) Receptor beta3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GABRD Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
Rabbit Polyclonal Anti-GABRA3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the middle region of human GABRA3. Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT |
Rabbit Polyclonal Anti-GABRB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRB1 antibody: synthetic peptide directed towards the N terminal of human GABRB1. Synthetic peptide located within the following region: TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT |
GABA A Receptor alpha 1 (GABRA1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
GABA A Receptor alpha 6 (GABRA6) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
GABA A Receptor delta (GABRD) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
GABA A Receptor alpha 3 (GABRA3) (480-492) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Bat, Bovine, Equine, Hamster, Human, Monkey, Mouse, Rabbit, Rat |
Immunogen | Synthetic peptide from C-Terminus of human GABRA3 (NP_000799.1) |
GLRB (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 103-132 amino acids from the N-terminal region of Human Glycine receptor beta |
GABA A Receptor beta 3 (GABRB3) goat polyclonal antibody
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-GABRA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EKAKRKTSKPPQE, from the internal region of the protein sequence according to NP_000800.2. |
Rabbit polyclonal anti-GABRA6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GABRA6. |
Rabbit polyclonal anti-GABRG1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GABRG1. |
Anti-GABRB1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.432~436 (R-A-S-Q-L) derived from Human GABRB1. |
Anti-Gabra3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa. 33~37(R-R-Q-E-P)derived from Rat GABA A Receptor a3. |
USD 410.00
5 Days
Mouse Monoclonal Anti-GABA(A) Receptor alpha1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 410.00
5 Days
Mouse Monoclonal Anti-GABA(A) Receptor beta1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-GABRB1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRB1 antibody: synthetic peptide directed towards the middle region of human GABRB1. Synthetic peptide located within the following region: VDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWV |
Rabbit Polyclonal anti-GABRB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: DIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSF |
Rabbit Polyclonal Anti-GABRB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: FYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK |
Rabbit Polyclonal anti-GABRR1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRR1 antibody: synthetic peptide directed towards the N terminal of human GABRR1. Synthetic peptide located within the following region: MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH |
Rabbit Polyclonal Anti-GLRA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLRA1 antibody: synthetic peptide directed towards the middle region of human GLRA1. Synthetic peptide located within the following region: TMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIE |
Rabbit Polyclonal Anti-GABRA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA2 antibody: synthetic peptide directed towards the middle region of human GABRA2. Synthetic peptide located within the following region: PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQ |
Rabbit Polyclonal Anti-GABRA3 Antibody
Applications | IHC |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the N terminal of human GABRA3. Synthetic peptide located within the following region: GTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRL |
Rabbit Polyclonal Anti-GABRD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
Rabbit Polyclonal Anti-GABRG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRG2 antibody: synthetic peptide directed towards the N terminal of human GABRG2. Synthetic peptide located within the following region: GFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDI |
Rabbit Polyclonal Anti-GABRP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
Rabbit Polyclonal Anti-GABRA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA1 antibody: synthetic peptide directed towards the N terminal of human GABRA1. Synthetic peptide located within the following region: WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL |
Rabbit Polyclonal Anti-GABRA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA1 antibody: synthetic peptide directed towards the middle region of human GABRA1. Synthetic peptide located within the following region: YDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL |
Rabbit Polyclonal Anti-Gabra3 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Gabra3 antibody is: synthetic peptide directed towards the N-terminal region of Rat Gabra3. Synthetic peptide located within the following region: LLISILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIF |