Germany
Japan
United Kingdom
China
USD 428.00
In Stock
Antibodies
Download
Rabbit Polyclonal RARA Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARA antibody: human RARA (Retinoic Acid Receptor alpha) using two KLH-conjugated synthetic peptides containing sequences from the C-terminal region of the protein. |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit Polyclonal Anti-NR2F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the N terminal of human NR2F2. Synthetic peptide located within the following region: QDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQG |
Rabbit Polyclonal PPARG Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit Polyclonal Anti-RORB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORB antibody: synthetic peptide directed towards the C terminal of human RORB. Synthetic peptide located within the following region: KNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYK |
Progesterone Receptor (PGR) mouse monoclonal antibody, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
Rabbit polyclonal antibody to RARRES3 (retinoic acid receptor responder (tazarotene induced) 3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 69 and 164 of RARRES3 (Uniprot ID#Q9UL19) |
Rabbit polyclonal anti-NR1I2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NR1I2. |
Rabbit Polyclonal Anti-NR2C2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the C terminal of human NR2C2. Synthetic peptide located within the following region: AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNS |
Rabbit Monoclonal antibody against NR5A2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Androgen Receptor (Ab-650) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 650 (T-T-SP-P-T). |
Anti-HNF4A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 241-254 amino acids of human hepatocyte nuclear factor 4, alpha |
Rabbit Polyclonal Vitamin D Receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Vitamin D Receptor |
Rabbit Polyclonal antibody to Retinoic Acid Receptor gamma (retinoic acid receptor, gamma)
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 119 and 454 of Retinoic Acid Receptor gamma |
Rabbit polyclonal NURR1 (NR4A2) Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This NURR1 (NR4A2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human NURR1 (NR4A2). |
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit anti-PPARD Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPARD |
Rabbit Polyclonal Anti-NR1H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the N terminal of human NR1H2. Synthetic peptide located within the following region: GNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPD |
Rabbit Polyclonal Anti-RARB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RARB |
PXR (NR1I2) (Center) rabbit polyclonal antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 100-127 aa selected from the Center region of human NR1I2 |
HNF 4 alpha (HNF4A) (2-15) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bat, Canine, Equine, Hamster, Human, Monkey, Porcine, Rabbit |
| Immunogen | Synthetic peptide from the N-terminus of human HNF4A / HNF4 (NP_849180.1; NP_000448.3; NP_849181.1) |
USD 516.00
In Stock
Rabbit Polyclonal antibody to COUP TF1 (nuclear receptor subfamily 2, group F, member 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 44 of COUP TF1 (Uniprot ID#P10589) |
RORB / ROR Beta Rabbit Polyclonal (Hinge Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chicken, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat, Sheep |
| Immunogen | RORB / ROR Beta antibody was raised against synthetic 18 amino acid peptide from hinge domain of human ROR Beta. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Platypus, Lizard (100%); Elephant, Xenopus (94%); Zebrafish (83%). |
Anti-NR1I2 Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | NR1I2 / PXR / PAR antibody was raised against synthetic peptide EQFAITLKSYIECNR from an internal region of human NR1I2 / PXR (NP_003880.3; NP_071285.1; NP_148934.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (93%); Horse, Pig (87%); Panda, Dog, Rabbit (80%). |
Rabbit polyclonal HNF4A Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A. |
Rabbit Polyclonal AhR (Ser36) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AhR around the phosphorylation site of Serine 36 |
| Modifications | Phospho-specific |
Rabbit anti-PTGES3 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PTGES3 |
Rabbit Polyclonal Anti-NR1I2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the C terminal of human NR1I2. Synthetic peptide located within the following region: PQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGI |
USD 440.00
2 Weeks
USD 480.00
2 Weeks
Active filters
Families
- Nuclear Hormone Receptor
Filter by
Target Symbol
- PGR (172)
- ESR1 (72)
- NR3C1 (68)
- ESRRA (55)
- NR2E3 (55)
- NR2C2 (52)
- PTGES3 (50)
- RARA (50)
- AR (47)
- NR2C1 (47)
- NR1I3 (46)
- PPARA (45)
- THRA (44)
- NR4A3 (42)
- HNF4A (39)
- ESRRG (38)
- ESRRB (35)
- ESR2 (33)
- RORB (33)
- RORA (27)
- NR1D2 (26)
- PPARD (21)
- NR1H3 (20)
- NR2F6 (17)
- PPARG (15)
- NR0B1 (14)
- AHR (13)
- VDR (13)
- NR4A1 (12)
- THRB (12)
- NR5A2 (11)
- NR1H2 (10)
- NR1H4 (9)
- NR1I2 (9)
- RARG (9)
- RARB (8)
- NR2F2 (7)
- RXRB (7)
- RXRG (7)
- NR2F1 (6)
- NR4A2 (6)
- RXRA (6)
- HNF4G (5)
- NR1D1 (5)
- TRIP4 (5)
- NR2E1 (4)
- PLAAT4 (4)
- MED1 (3)
- NR3C2 (3)
- PGRMC1 (3)
- PGRMC2 (1)
- ZNF335 (1)
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Oocyte meiosis (219)
- Progesterone-mediated oocyte maturation (172)
- Pathways in cancer (161)
- Neuroactive ligand-receptor interaction (124)
- PPAR signaling pathway (121)
- Acute myeloid leukemia (71)
- Adipocytokine signaling pathway (65)
- Maturity onset diabetes of the young (55)
- Prostate cancer (47)
- Thyroid cancer (35)
- Non-small cell lung cancer (28)
- Small cell lung cancer (28)
- Wnt signaling pathway (21)
- Huntington's disease (15)
- MAPK signaling pathway (12)
- Circadian rhythm - mammal (5)