Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit Polyclonal RARA Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARA antibody: human RARA (Retinoic Acid Receptor alpha) using two KLH-conjugated synthetic peptides containing sequences from the C-terminal region of the protein. |
PTCH1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1) |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit anti-FADD Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FADD |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Collagen IV (COL4A1) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Feline, Fish, Human, Mouse, Porcine, Rat |
| Immunogen | Human placental type IV Collagen. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit polyclonal anti-LAMA1 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMA1. |
Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Active filters
Pathways
- Pathways in cancer
Filter by
Target Symbol
- TP53 (255)
- ERBB2 (239)
- MAP2K1 (237)
- EGFR (207)
- CDKN2A (198)
- JUN (183)
- CTNNB1 (162)
- GLI1 (151)
- IL6 (144)
- AKT1 (127)
- MDM2 (121)
- NKX3-1 (115)
- BRAF (100)
- BCL2 (99)
- KIT (93)
- MLH1 (88)
- STAT5A (76)
- FGF21 (75)
- MAPK1 (74)
- MTOR (72)
- CDH1 (69)
- FGFR2 (66)
- FOXO1 (65)
- FOS (64)
- MET (64)
- PIK3CG (64)
- CDK2 (63)
- PDGFRA (63)
- KLK3 (62)
- MYC (61)
- RET (61)
- BID (60)
- RB1 (59)
- KRAS (58)
- MAPK8 (55)
- RELA (54)
- VEGFA (53)
- STAT1 (52)
- PDGFRB (50)
- RARA (50)
- CASP3 (49)
- HDAC1 (49)
- PTGS2 (48)
- AR (47)
- HRAS (47)
- PIK3R5 (47)
- RASSF1 (47)
- WNT3 (47)
- RALBP1 (46)
- AKT2 (44)
- BIRC3 (44)
- BIRC5 (43)
- FGFR1 (43)
- IKBKG (41)
- PTK2 (41)
- DVL2 (40)
- EGF (38)
- LAMB3 (38)
- ARNT (37)
- CCND1 (37)
- CDKN1A (36)
- CDKN2B (36)
- NFKB1 (36)
- PTCH1 (36)
- BAX (35)
- PIK3CD (35)
- MAP2K2 (34)
- SMAD2 (34)
- RAF1 (33)
- STAT3 (33)
- FGF2 (31)
- FN1 (31)
- HGF (31)
- IGF1 (31)
- KITLG (31)
- MAPK9 (31)
- DAPK2 (30)
- NFKBIA (30)
- BCL2L1 (29)
- HIF1A (29)
- HSP90AB1 (29)
- IGF1R (29)
- ITGB1 (27)
- NOS2 (27)
- PRKCA (27)
- CASP9 (26)
- CHUK (26)
- CSF2RA (26)
- CXCL8 (26)
- HDAC2 (26)
- NCOA4 (26)
- NOS3 (25)
- PIK3CA (25)
- ARAF (24)
- FH (24)
- HSP90AA1 (24)
- SMAD3 (24)
- VEGFB (24)
- VEGFD (24)
- CSF1R (23)
Reactivities
- Human (7192)
- Mouse (4985)
- Rat (4642)
- Monkey (637)
- Dog (601)
- Bovine (87)
- Pig (61)
- Chicken (53)
- Cow (37)
- Rabbit (32)
- Canine (26)
- Primate (24)
- Xenopus (24)
- Hamster (23)
- Horse (19)
- Bat (14)
- Gorilla (13)
- Rhesus Monkey (11)
- Gibbon (10)
- Zebrafish (10)
- Sheep (9)
- Drosophila (8)
- Feline (8)
- Porcine (8)
- Chimpanzee (6)
- Guinea Pig (6)
- Gerbil (4)
- X. tropicalis (4)
- Canis (3)
- Ferret (3)
- C. elegans (2)
- Equine (2)
- Fish (2)
- Frog (2)
- Macaque (2)
- Yeast (2)
- Fungi (1)
- Goat (1)
- Insect (1)
- Mammalian (1)
- Opossum (1)
- Orang-Utan (1)
- Plant (1)
- Quail (1)
- Tobacco hornworm (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (7634)
- Transcription Factors (2343)
- ES Cell Differentiation/IPS (2332)
- Protein Kinase (2236)
- Transmembrane (1810)
- Secreted Protein (1282)
- Stem cell - Pluripotency (820)
- Adult stem cells (768)
- Embryonic stem cells (555)
- Cancer stem cells (515)
- Stem cell relevant signaling - JAK/STAT signaling pathway (479)
- Stem cell relevant signaling - DSL/Notch pathway (335)
- Protease (245)
- Stem cell relevant signaling - Wnt Signaling pathway (180)
- Nuclear Hormone Receptor (161)
- Induced pluripotent stem cells (158)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (148)
- GPCR (44)
- Phosphatase (23)