Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
Download
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal RARA Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARA antibody: human RARA (Retinoic Acid Receptor alpha) using two KLH-conjugated synthetic peptides containing sequences from the C-terminal region of the protein. |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit Polyclonal Anti-PML Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PML antibody: synthetic peptide directed towards the middle region of human PML. Synthetic peptide located within the following region: TTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQ |
Rabbit Polyclonal ETO Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETO antibody: human ETO (runt-related transcription factor 1; translocated to, 1 (cyclin D-related)) using two KLH-conjugated synthetic peptides containing sequences from the N-terminal and the central region of the protein, respect |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal RUNX1 Antibody (S276)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RUNX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from human RUNX1. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A (Ser780) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Serine 780 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A/B (Ser725/730) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A/B around the phosphorylation site of Serine 725/730 |
| Modifications | Phospho-specific |
Rabbit Polyclonal AML-ETO Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AML-ETO antibody: the AML-ETO (RUNX1) fusion protein, using 3 different KLH-conjugated synthetic peptides. The antibody recognizes the ETO (RUNX1T1) part of the fusion protein. |
Rabbit Polyclonal SPI1 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPI1 antibody: mouse SPI1 (spleen focus forming virus (SFFV) proviral integration oncogene), using two KLH-conjugated synthetic peptides containing a sequence from the N-terminus and from the C-terminus of the protein, respectively. |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Acute myeloid leukemia
Filter by
Target Symbol
- MAP2K1 (237)
- AKT1 (127)
- BRAF (100)
- KIT (93)
- STAT5A (76)
- MAPK1 (74)
- MTOR (72)
- PIK3CG (64)
- MYC (61)
- KRAS (58)
- RELA (54)
- RPS6KB1 (54)
- RARA (50)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- IKBKG (41)
- PIM2 (39)
- CCND1 (37)
- NFKB1 (36)
- PIK3CD (35)
- MAP2K2 (34)
- RAF1 (33)
- STAT3 (33)
- EIF4EBP1 (27)
- CHUK (26)
- PIK3CA (25)
- ARAF (24)
- MAPK3 (23)
- JUP (22)
- BAD (21)
- PPARD (21)
- IKBKB (20)
- AKT3 (19)
- STAT5B (18)
- FLT3 (17)
- NRAS (17)
- RUNX1 (16)
- SPI1 (15)
- CEBPA (14)
- PIK3R1 (14)
- GRB2 (11)
- LEF1 (11)
- PIM1 (11)
- RUNX1T1 (11)
- CCNA1 (9)
- PML (9)
- TCF7 (9)
- BMP2 (8)
- RPS6KB2 (7)
- SKP2 (6)
- PIK3CB (4)
- PIK3R3 (4)
- TCF7L2 (4)
- ZBTB16 (4)
- SOS2 (3)
- TCF7L1 (3)
- B RAF (2)
- PIK3R2 (2)
- SOS1 (2)
- UBE2Z (2)
Reactivities
- Human (1778)
- Mouse (1552)
- Rat (1460)
- Dog (354)
- Monkey (342)
- Bovine (24)
- Pig (16)
- Chicken (14)
- Cow (9)
- Xenopus (8)
- Rabbit (7)
- Drosophila (4)
- Hamster (4)
- Primate (3)
- Rhesus Monkey (3)
- Canine (2)
- Canis (2)
- Chimpanzee (2)
- Sheep (2)
- Zebrafish (2)
- Equine (1)
- Feline (1)
- Guinea Pig (1)
- X. tropicalis (1)
- Yeast (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (1949)
- Protein Kinase (1056)
- ES Cell Differentiation/IPS (550)
- Transcription Factors (492)
- Stem cell relevant signaling - JAK/STAT signaling pathway (192)
- Stem cell - Pluripotency (191)
- Embryonic stem cells (162)
- Transmembrane (118)
- Stem cell relevant signaling - DSL/Notch pathway (113)
- Adult stem cells (112)
- Stem cell relevant signaling - Wnt Signaling pathway (98)
- Nuclear Hormone Receptor (71)
- Induced pluripotent stem cells (69)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (69)
- Cancer stem cells (8)
- Secreted Protein (8)