Germany
Japan
United Kingdom
China
USD 420.00
In Stock
Antibodies
Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Anti-PNPLA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
USD 379.00
In Stock
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
USD 379.00
In Stock
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal Anti-ACO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Rabbit Polyclonal Anti-UMPS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UMPS antibody: synthetic peptide directed towards the C terminal of human UMPS. Synthetic peptide located within the following region: VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
USD 399.00
In Stock
Anti-IDH1 mouse mAb, clone OTI2H9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 399.00
In Stock
Anti-IDH1 mouse mAb, clone OTI2H9, DyLight488 conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | DyLight 488 |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-TDO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TDO2 antibody: synthetic peptide directed towards the N terminal of human TDO2. Synthetic peptide located within the following region: LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
USD 399.00
In Stock
Anti-IDH1 mouse mAb, clone OTI2H9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926) |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II). |
Rabbit Polyclonal Anti-BHMT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE |
Rabbit Polyclonal Anti-LDHB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD |
Active filters
Pathways
- Metabolic pathways
Filter by
Target Symbol
- NME1 (177)
- LIPG (133)
- OTC (127)
- PIK3C2A (112)
- PNMT (89)
- TYMS (89)
- LTA4H (68)
- MGLL (68)
- FTCD (64)
- ABAT (62)
- AMACR (62)
- IDO1 (62)
- IDO2 (61)
- TYMP (60)
- GAPDH (59)
- SMS (59)
- ACAT2 (57)
- CYP1A2 (57)
- TH (57)
- ACY1 (56)
- RRM1 (56)
- NME4 (55)
- PGAM2 (55)
- ASS1 (54)
- ACSS2 (53)
- ATP5F1B (53)
- AKR1A1 (52)
- ATP6V1C2 (52)
- HADH (52)
- PFKP (52)
- NDUFA7 (51)
- PPAT (51)
- RPN1 (51)
- SORD (51)
- TBXAS1 (51)
- GCH1 (50)
- HIBCH (50)
- NANP (50)
- AK4 (49)
- ALOX5 (49)
- PYCR2 (48)
- SDS (48)
- SPR (48)
- AK5 (47)
- ARG1 (47)
- CMPK1 (47)
- UCK1 (46)
- DTYMK (45)
- PKLR (44)
- ACAA2 (43)
- KHK (43)
- AMDHD1 (41)
- DLD (41)
- GRHPR (41)
- PYCR3 (41)
- THTPA (41)
- QPRT (40)
- CYP2J2 (39)
- NDUFB10 (39)
- UPRT (39)
- DGKA (37)
- GBA (37)
- MCEE (37)
- PISD (37)
- ALDH3A2 (36)
- COX6A1 (36)
- GBE1 (36)
- NFKB1 (36)
- PAFAH1B3 (36)
- ADH1B (35)
- AK1 (35)
- EPHX2 (35)
- ANPEP (34)
- CD38 (34)
- GPI (34)
- NDUFB9 (34)
- SHMT2 (34)
- CYP17A1 (33)
- CYP2A6 (33)
- PON3 (33)
- SDHB (33)
- ENO2 (32)
- HMBS (32)
- POLR2H (32)
- PON1 (32)
- PAPSS2 (31)
- PGAM4 (31)
- ADH5 (30)
- HAO1 (30)
- IDH1 (30)
- LDHA (30)
- MMAB (30)
- NNMT (30)
- BHMT (29)
- GAD1 (29)
- HSD17B10 (29)
- PRDX6 (29)
- GLB1 (28)
- GSS (27)
- MTHFR (27)
Reactivities
- Human (8681)
- Mouse (5282)
- Rat (4999)
- Dog (642)
- Monkey (598)
- Bovine (119)
- Pig (99)
- Cow (72)
- Chicken (39)
- Xenopus (34)
- Rabbit (28)
- X. tropicalis (26)
- Zebrafish (26)
- Chimpanzee (22)
- Rhesus Monkey (19)
- Primate (15)
- Porcine (12)
- Hamster (10)
- Drosophila (9)
- Gibbon (9)
- Gorilla (9)
- Canine (8)
- Feline (8)
- Orang-Utan (8)
- Horse (7)
- Yeast (6)
- Sheep (5)
- Goat (4)
- Guinea Pig (4)
- Avian (2)
- Bacteria (2)
- Bat (2)
- Insect (2)
- Murine (2)
- All Species (1)
- Baboon (1)
- C. elegans (1)
- Equine (1)
- Frog (1)
- Fruit fly (1)
- Invertebrate (1)
- Marmoset (1)
- Protozoa (1)
- Saccharomyces cerevisiae (1)