Antibodies

View as table Download

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

Collagen I (COL1A1) rabbit polyclonal antibody, Biotin

Applications ELISA, FC, IHC, IP, WB
Reactivities Bovine, Human, Mammalian, Mouse, Rat
Conjugation Biotin
Immunogen Collagen Type I from Human and Bovine placenta.

Rabbit Anti-Collagen 1, alpha 1 telopeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 telopeptide conjugated to KLH

Collagen I mouse monoclonal antibody, clone 3G3, Purified from ascites by Protein A

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Human
Immunogen Purified Collagen type I from Human skin.

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Porcine
Immunogen Purified Collagen type I from Porcine tendon.

Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free

Applications ELISA, IF, IHC
Reactivities Fish
Immunogen Collagen Type I extracted and purified from salmon fish skin.

Col1a1 rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Mouse
Immunogen Purified Collagen type I from Mouse skin

Rabbit Polyclonal Anti-COL1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS

COL1A1 rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bovine
Immunogen Purified Collagen type I from Bovine skin.

Collagen I (COL1A2) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the N-terminus of Human COL1A2.

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bonito, Salmon, Sole, Tuna
Immunogen Purified Collagen type I from Salmon skin

Col1a1 rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Mouse
Immunogen Native type I Collagen from Mouse skin.

Collagen I (COL1A1) (+ type III) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Human, Porcine
Immunogen Porcine Collagen, types 1 and 3 from skin

Collagen I (COL1A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Collagen Type I from Human and Bovine Placenta

Collagen I (COL1A1) mouse monoclonal antibody, clone NFI/20, Purified

Applications ELISA, IHC
Reactivities Human

Collagen I (COL1A1) (+ type II, III, IV, and V) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC
Reactivities Human
Immunogen A mixture of human collagen 1-5 from human placenta.

COL1A1 rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bovine
Immunogen Purified Collagen type I from Bovine skin.

Col1a1 rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Mouse
Immunogen Purified Collagen type I from Mouse skin

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Fish, Goldfish
Immunogen Purified collagen type I from goldfish skin

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bonito, Salmon, Sole, Tuna
Immunogen Purified Collagen type I from Salmon skin

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bonito, Fish, Tuna
Immunogen Purified Collagen type I from Tuna Fish skin

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Bonito, Fish, Tuna
Immunogen Purified Collagen type I from Tuna Fish skin

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Porcine
Immunogen Purified Collagen type I from Porcine tendon.

Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free

Applications ELISA, IF, IHC
Reactivities Human
Immunogen Collagen I antibody was raised against human placental collagen Type I.

Collagen I (COL1A1) mouse monoclonal antibody, clone BDI314, Azide Free

Applications ELISA, IHC
Reactivities Human

Collagen I (COL1A1) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Human type 1 Collagen

Rabbit Polyclonal Anti-COL1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC

Collagen I (COL1A1) goat polyclonal antibody, Biotin

Applications ELISA
Reactivities Human
Conjugation Biotin
Immunogen Human type 1 collagen

Rabbit Polyclonal Collagen I alpha 1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Collagen I protein (between residues 150-200) [UniProt P02452]

Rabbit Polyclonal Collagen I alpha 1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal portion of the human Collagen I protein (between residues 1300-1350) [UniProt P02452]

Rabbit anti Collagen I Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein encoding aa 1160-1367 of human collagen I expressed in E.Coli.

COL1A1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human COL1A1 (NP_000079.2).
Modifications Unmodified

COL1A1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human COL1A1.
Modifications Unmodified

Collagen I alpha 1 (4C4) Mouse monoclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Collagen I alpha 1 Rabbit monoclonal Antibody

Applications IF, IP, WB
Reactivities Human
Conjugation Unconjugated