Germany
Japan
United Kingdom
China
WNT Pathway Markers-Antibodies
View as table Download
Frizzled 5 (FZD5) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
Frizzled 9 (FZD9) (N-term, Extracel. Dom.) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Bovine, Canine, Human |
| Immunogen | Synthetic 15 amino acid peptide from N-terminal extracellular domain of human FZD9 / Frizzled 9 |
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
Rabbit Polyclonal Anti-WNT5B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the middle region of human WNT5B. Synthetic peptide located within the following region: YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC |
USD 465.00
2 Weeks
JNK1 (MAPK8) (pT-G/P-pY Motif) (incl. pos. control) mouse monoclonal antibody, clone 9H8, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human, Mouse |
USD 465.00
2 Weeks
MEK7 (MAP2K7) (incl. pos. control) mouse monoclonal antibody, clone 10F7, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat |
MAPK8 / MAPK9 pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic phospho-peptide corresponding to residues surrounding Thr183/Tyr185 of Human SAPK/JNK |
Frizzled 7 (FZD7) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 61-110 of Human Frizzled-7. |
Frizzled 9 (FZD9) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 571-620 of Human Frizzled-9. |
LRP6 (Internal) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Canine, Equine, Hamster, Human, Monkey, Porcine, Rabbit, Rat |
| Immunogen | Synthetic peptide from an internal region of human LRP6 (NP_002327.2) |
Apolipoprotein CII (APOC2) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | ApoLipoprotein Type C-II produced synthetically in full-length form (not selected epitopes) using conventional peptide technology |
Apc11 (ANAPC11) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human |
| Immunogen | This APC11 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 76-84 of Human APC11 (C-terminal) coupled to KLH. |
Apc2 (ANAPC2) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 810-822 of Human APC2 (C-terminal) coupled to KLH. |
Rabbit Polyclonal Antibody against LRP6 (C-term T1546)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LRP6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1531-1560 amino acids from the C-terminal region of human LRP6. |
Goat Polyclonal Antibody against WNT4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNWLYLAKLSSVGS, from the internal region of the protein sequence according to NP_110388.2. |
Goat Polyclonal Antibody against FZD4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DEEERRCDPIRIS, from the internal region of the protein sequence according to NP_036325.2. |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
Rabbit polyclonal anti-ROR2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ROR2. |
Rabbit polyclonal anti-FZD10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD10. |
WNT2B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Anti-ROR1 Goat Polyclonal () Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ROR1 antibody was raised against synthetic peptide C-GNKSQKPYKIDSKQA from the C-terminus (near) of human ROR1 (NP_005003.2). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Lizard (93%); Turkey, Chicken (87%); Platypus (80%). |
Rabbit polyclonal anti-Wnt-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Rabbit Polyclonal Anti-TCF21 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF21 Antibody: synthetic peptide directed towards the N terminal of human TCF21. Synthetic peptide located within the following region: SNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQRNAANARERAR |
Rabbit Polyclonal Anti-FZD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD2 antibody: synthetic peptide directed towards the N terminal of human FZD2. Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI |
Rabbit Polyclonal Anti-FZD5 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the middle region of human FZD5. Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT |
Rabbit Polyclonal Anti-FZD5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the C terminal of human FZD5. Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH |
Rabbit Polyclonal Anti-FZD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD6 antibody: synthetic peptide directed towards the middle region of human FZD6. Synthetic peptide located within the following region: HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGS |
Rabbit Polyclonal Anti-Wnt11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wnt11 antibody is: synthetic peptide directed towards the middle region of Mouse Wnt11. Synthetic peptide located within the following region: PGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQA |
Rabbit Polyclonal Anti-FZD10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10. Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the middle region of human WNT16. Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the C terminal of human WNT16. Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLL |
Rabbit Polyclonal Anti-Wnt10a Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt10a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RDQRWNCSSLETRNKVPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACA |
Active filters
Category
-
Antibodies
- Primary Antibodies
Filter by
Target Symbol
- MAPK8 (64)
- WNT3 (47)
- DVL2 (42)
- ANAPC11 (34)
- ROR2 (34)
- ANAPC2 (33)
- MAPK9 (31)
- RORA (28)
- PTK7 (20)
- MAPK10 (19)
- ROCK2 (17)
- LEF1 (15)
- ROR1 (15)
- WNT1 (13)
- FZD4 (11)
- ANAPC5 (10)
- ROCK1 (10)
- WNT2B (10)
- WNT3A (10)
- WNT5B (10)
- LRP6 (9)
- FZD2 (8)
- TCF25 (8)
- WNT10A (8)
- FZD1 (7)
- FZD8 (7)
- FZD9 (7)
- LRP5 (7)
- TCF4 (7)
- TCF7L2 (7)
- WNT16 (7)
- WNT2 (7)
- WNT4 (7)
- WNT6 (7)
- ANAPC10 (6)
- FZD10 (6)
- WNT5A (6)
- WNT9A (6)
- DVL3 (5)
- FZD3 (5)
- FZD5 (5)
- FZD6 (5)
- WNT11 (5)
- ANAPC13 (4)
- TCF21 (4)
- ANAPC15 (3)
- APC2 (3)
- FZD7 (3)
- INTS1 (3)
- WNT7A (3)
- MAP2K4 (2)
- RYK (2)
- SLC25A23 (2)
- WNT7B (2)
- APOC2 (1)
- DVL1 (1)
- JKK-1 (1)
- LRP5L (1)
- MAP2K7 (1)
Reactivities
- Human (589)
- Mouse (488)
- Rat (419)
- Dog (36)
- Monkey (34)
- Bovine (23)
- Chicken (12)
- Rabbit (12)
- Hamster (11)
- Gorilla (10)
- Bat (9)
- Horse (9)
- Gibbon (8)
- Pig (7)
- Canis (5)
- Primate (3)
- Xenopus (3)
- Guinea Pig (2)
- C. elegans (1)
- Canine (1)
- Chimpanzee (1)
- Cow (1)
- Frog (1)
- Macaque (1)
- Opossum (1)
- Orang-Utan (1)
- Sheep (1)
- Tobacco hornworm (1)
Antibody Hosts
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (503)
- Transmembrane (222)
- Protein Kinase (192)
- ES Cell Differentiation/IPS (176)
- Secreted Protein (125)
- Transcription Factors (48)
- Adult stem cells (45)
- GPCR (44)
- Cancer stem cells (34)
- Stem cell relevant signaling - Wnt Signaling pathway (34)
- Nuclear Hormone Receptor (26)
- Induced pluripotent stem cells (8)
Pathways
- Wnt signaling pathway (372)
- Pathways in cancer (340)
- Basal cell carcinoma (238)
- Melanogenesis (235)
- Colorectal cancer (215)
- Progesterone-mediated oocyte maturation (180)
- Hedgehog signaling pathway (125)
- Focal adhesion (123)
- ErbB signaling pathway (105)
- Fc epsilon RI signaling pathway (105)
- GnRH signaling pathway (105)
- MAPK signaling pathway (105)
- Toll-like receptor signaling pathway (105)
- Epithelial cell signaling in Helicobacter pylori infection (104)
- Neurotrophin signaling pathway (103)
- Adipocytokine signaling pathway (102)
- Insulin signaling pathway (102)
- NOD-like receptor signaling pathway (102)
- Pancreatic cancer (102)
- RIG-I-like receptor signaling pathway (102)
- Type II diabetes mellitus (102)
- Cell cycle (78)
- Oocyte meiosis (78)
- Ubiquitin mediated proteolysis (78)
- Notch signaling pathway (43)
- T cell receptor signaling pathway (31)
- Regulation of actin cytoskeleton (24)
- Axon guidance (21)
- Chemokine signaling pathway (21)
- Leukocyte transendothelial migration (21)
- Pathogenic Escherichia coli infection (21)
- TGF-beta signaling pathway (21)
- Vascular smooth muscle contraction (21)
- Endometrial cancer (18)
- Acute myeloid leukemia (15)
- Adherens junction (15)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (15)
- Prostate cancer (15)
- Thyroid cancer (15)