Germany
Japan
United Kingdom
China
USD 428.00
In Stock
Products
Download
USD 180.00
In Stock
Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Sheep |
| Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
PGK1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Thermolysin rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bacillus sp. |
| Immunogen | Thermolysin isolated and purified from Bacillus thermoproteolyticus rokko. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
OVAL rabbit polyclonal antibody, Biotin, Purified
| Applications | ELISA, IP, WB |
| Reactivities | Chicken |
| Conjugation | Biotin |
| Immunogen | Native Ovalbumin from hen egg white |
Rabbit Polyclonal Anti-HNRPA0 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
Collagen IV (COL4A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type IV purified from Human and Bovine placenta. |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
Rabbit Polyclonal H3K27me3S28p Antibody
| Applications | Dot, ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me3S28p antibody: histone H3 containing the trimethylated lysine 27 and the phosphorylated serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3S10p Antibody
| Applications | Dot, ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide. |
TDH1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | Glyceraldehyde-3-Phosphate Dehydrogenase isolated and purified from Baker's Yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-HNRPL Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
Hepatitis B X Protein / HBx rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IP, WB |
| Immunogen | Recombinant Hepatitis B Protein X from E. coli. |
Rabbit anti-Histone H4K20me2 Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K20 of human histone H4 |
Rabbit Polyclonal Anti-EIF3G Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF3G antibody: synthetic peptide directed towards the middle region of human EIF3G. Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR |
OVAL rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Chicken |
| Immunogen | Ovalbumin from Hen Egg White (native protein) |
Anti-GST rabbit polyclonal antibody
| Applications | IP, WB |
| Immunogen | Rabbits were immunized with recombinant Glutathione-S-transferase (GST) from E.coli . After multiple immunizations in Freund's adjuvant serum was collected. Antibodies were immunoaffinity purified using GST immobilized on a solid support. |
Rabbit Polyclonal Anti-ARF1 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA |
Caspase 1 (CASP1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 132 of Human Caspase-1. |
PGI1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | Phosphoglucose isomerase isolated and purified from baker’s yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Active filters
Applications
- IP
Antibody Hosts
- Rabbit
Filter by
Target Symbol
- H3-4 (18)
- ALB (13)
- TP53 (11)
- DDK (10)
- EGFR (10)
- MDH1 (9)
- AKT1 (8)
- HIST1H3A (8)
- C2 (7)
- BAX (6)
- CA1 (6)
- CREB1 (6)
- CTNNB1 (6)
- GALM (6)
- HISTONE H3 (6)
- LDHB (6)
- RNASE1 (6)
- S PROTEIN (6)
- SQSTM1 (6)
- CDK1 (5)
- EIF4E (5)
- EIF4EBP1 (5)
- GSK3B (5)
- H3C1 (5)
- JUN (5)
- LDHA (5)
- MAPK1 (5)
- RELA (5)
- STAT1 (5)
- STAT3 (5)
- CASP3 (4)
- CAT (4)
- CD40 (4)
- CDK2 (4)
- CDK4 (4)
- CDKN1A (4)
- COL1A1 (4)
- COL6A1 (4)
- CP (4)
- CYCS (4)
- GLUD1 (4)
- GRIA2 (4)
- HSPB1 (4)
- MAPK14 (4)
- MAPK8 (4)
- MAPT (4)
- MCM5 (4)
- MCM7 (4)
- NF2 (4)
- NFKBIA (4)
- PDHA1 (4)
- PLG (4)
- SMAD2 (4)
- SOD1 (4)
- VCAM1 (4)
- XRCC5 (4)
- YAP1 (4)
- ACLY (3)
- ACTA1 (3)
- ATF2 (3)
- BAK1 (3)
- BCHE (3)
- BCL2 (3)
- BCL2L1 (3)
- CBX3 (3)
- CCND1 (3)
- CCR5 (3)
- CD22 (3)
- CD3E (3)
- CD74 (3)
- CDC37 (3)
- CDKN2A (3)
- CES1 (3)
- CHEK2 (3)
- COL5A1 (3)
- CPA1 (3)
- CS (3)
- CTCF (3)
- CTNNA1 (3)
- CTSC (3)
- DDB1 (3)
- DDK (FLAG) (3)
- DNMT1 (3)
- ENO1 (3)
- EZH2 (3)
- FADD (3)
- FBL (3)
- FLOT1 (3)
- FUBP1 (3)
- FUCA1 (3)
- GYS1 (3)
- H2AX (3)
- H2BC12 (3)
- H2BC3 (3)
- HADH (3)
- HADHA (3)
- HIF1A (3)
- HIST3H3 (3)
- HMOX1 (3)
- IGF2BP3 (3)
Reactivities
- Human (1372)
- Mouse (1044)
- Rat (904)
- Monkey (22)
- Other (Wide Range) (22)
- Bovine (21)
- Hamster (19)
- C-term DDK (10)
- Chicken (9)
- Pig (8)
- SARS-CoV-2 (7)
- Zebrafish (7)
- Sheep (6)
- Rabbit (5)
- Rhesus Monkey (5)
- Xenopus (5)
- X. tropicalis (4)
- Chimpanzee (3)
- Cow (3)
- Dog (3)
- Goat (3)
- Primate (3)
- Broad (2)
- Cynomolgus (2)
- Fusion proteins containing the Flag Tag (2)
- N-term and C-term DDK (2)
- Saccharomyces cerevisiae (2)
- Baboon (1)
- C. elegans (1)
- Canine (1)
- Drosophila melanogaster (1)
- Feline (1)
- Ferret (1)
- Fish (1)
- Guinea Pig (1)
- Macaque (1)
- Marmoset (1)
- Streptococcus Pyogenes (1)
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (347)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (27)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (13)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (10)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (7)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (5)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (5)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgM format, for improved compatibility with existing reagents, assays and techniques. (3)
- Phospho S15 (2)
- Phospho S727 (2)
- Phospho S9 (2)
- Phospho-specific (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K27 (1)
- Acetyl K5 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- MonoMethyl K36 (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S157 (1)
- Phospho S2 (1)
- Phospho S21 (1)
- Phospho S22 (1)
- Phospho S240/244 (1)
- Phospho S259 (1)
- Phospho S298 (1)
- Phospho S33 (1)
- Phospho S380 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S473 (1)
- Phospho S51 (1)
- Phospho S621 (1)
- Phospho S65 (1)
- Phospho S82 (1)
- Phospho S957 (1)
- Phospho T183/T172 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T359 (1)
- Phospho T669 (1)
- Phospho Y1068 (1)
- Phospho Y15 (1)
- Phospho Y416/Y416 (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- TriMethyl K56 (1)
- pan-Mono-Methyl K (1)
- pan-tri-Methyl K (1)
Assay Types
Families
- Druggable Genome (202)
- Transcription Factors (56)
- Transmembrane (42)
- Secreted Protein (29)
- Protein Kinase (23)
- Stem cell - Pluripotency (23)
- Protease (19)
- ES Cell Differentiation/IPS (14)
- Nuclear Hormone Receptor (5)
- Phosphatase (5)
- Adult stem cells (2)
- GPCR (2)
- Ion Channels: Potassium (2)
- Cancer stem cells (1)
- Embryonic stem cells (1)
- Induced pluripotent stem cells (1)
- Ion Channels: Calcium (1)
- Ion Channels: Transient receptor potential (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (1)
Pathways
- Systemic lupus erythematosus (41)
- Pathways in cancer (32)
- Metabolic pathways (26)
- Focal adhesion (22)
- MAPK signaling pathway (20)
- Cell cycle (18)
- Complement and coagulation cascades (15)
- Neurotrophin signaling pathway (14)
- Chronic myeloid leukemia (13)
- Huntington's disease (13)
- Insulin signaling pathway (13)
- ECM-receptor interaction (12)
- Prostate cancer (12)
- Toll-like receptor signaling pathway (12)
- Acute myeloid leukemia (11)
- Small cell lung cancer (11)
- T cell receptor signaling pathway (11)
- Adipocytokine signaling pathway (10)
- Apoptosis (10)
- Pyruvate metabolism (10)
- mTOR signaling pathway (10)
- Colorectal cancer (9)
- Chemokine signaling pathway (8)
- Citrate cycle (TCA cycle) (8)
- ErbB signaling pathway (8)
- Gap junction (8)
- Leukocyte transendothelial migration (8)
- Oocyte meiosis (8)
- Pathogenic Escherichia coli infection (8)
- RIG-I-like receptor signaling pathway (8)
- Renal cell carcinoma (8)
- Tight junction (8)
- Amyotrophic lateral sclerosis (ALS) (7)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (7)
- B cell receptor signaling pathway (7)
- Cytokine-cytokine receptor interaction (7)
- DNA replication (7)
- Endocytosis (7)
- Glioma (7)
- Glycolysis / Gluconeogenesis (7)
- Neuroactive ligand-receptor interaction (7)
- Pancreatic cancer (7)
- Progesterone-mediated oocyte maturation (7)
- Regulation of actin cytoskeleton (7)
- TGF-beta signaling pathway (7)
- Wnt signaling pathway (7)
- Endometrial cancer (6)
- Fc epsilon RI signaling pathway (6)
- Glyoxylate and dicarboxylate metabolism (6)
- Melanogenesis (6)
- Natural killer cell mediated cytotoxicity (6)
- Notch signaling pathway (6)
- VEGF signaling pathway (6)
- Adherens junction (5)
- Alzheimer's disease (5)
- Dilated cardiomyopathy (5)
- Epithelial cell signaling in Helicobacter pylori infection (5)
- Fc gamma R-mediated phagocytosis (5)
- Hypertrophic cardiomyopathy (HCM) (5)
- Melanoma (5)
- NOD-like receptor signaling pathway (5)
- Non-homologous end-joining (5)
- Non-small cell lung cancer (5)
- Nucleotide excision repair (5)
- Porphyrin and chlorophyll metabolism (5)
- Prion diseases (5)
- Proteasome (5)
- Purine metabolism (5)
- Pyrimidine metabolism (5)
- RNA degradation (5)
- Spliceosome (5)
- Ubiquitin mediated proteolysis (5)
- GnRH signaling pathway (4)
- Hematopoietic cell lineage (4)
- Jak-STAT signaling pathway (4)
- Long-term potentiation (4)
- Thyroid cancer (4)
- Vascular smooth muscle contraction (4)
- p53 signaling pathway (4)
- Axon guidance (3)
- Basal cell carcinoma (3)
- Calcium signaling pathway (3)
- Cell adhesion molecules (CAMs) (3)
- Cytosolic DNA-sensing pathway (3)
- Nitrogen metabolism (3)
- PPAR signaling pathway (3)
- Parkinson's disease (3)
- Primary immunodeficiency (3)
- Propanoate metabolism (3)
- RNA polymerase (3)
- Type II diabetes mellitus (3)
- Vibrio cholerae infection (3)
- Antigen processing and presentation (2)
- Bladder cancer (2)
- Butanoate metabolism (2)
- Cysteine and methionine metabolism (2)
- Fatty acid metabolism (2)
- Glycine (2)
- Histidine metabolism (2)
- Homologous recombination (2)
- Long-term depression (2)
- Lysine degradation (2)
- Mismatch repair (2)
- Riboflavin metabolism (2)
- Selenoamino acid metabolism (2)
- Taste transduction (2)
- Valine (2)
- Viral myocarditis (2)
- serine and threonine metabolism (2)
- Allograft rejection (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Androgen and estrogen metabolism (1)
- Arachidonic acid metabolism (1)
- Asthma (1)
- Autoimmune thyroid disease (1)
- Biosynthesis of unsaturated fatty acids (1)
- Cardiac muscle contraction (1)
- Cyanoamino acid metabolism (1)
- Fatty acid biosynthesis (1)
- Fatty acid elongation in mitochondria (1)
- Folate biosynthesis (1)
- Fructose and mannose metabolism (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- Graft-versus-host disease (1)
- Hedgehog signaling pathway (1)
- Limonene and pinene degradation (1)
- Lysosome (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Methane metabolism (1)
- One carbon pool by folate (1)
- Oxidative phosphorylation (1)
- Regulation of autophagy (1)
- SNARE interactions in vesicular transport (1)
- Starch and sucrose metabolism (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- beta-Alanine metabolism (1)
- leucine and isoleucine biosynthesis (1)
- leucine and isoleucine degradation (1)