Germany
Japan
United Kingdom
China
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Products
View as table DownloadRabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TPM1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the N terminal of human TPM1. Synthetic peptide located within the following region: DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE |
USD 340.00
2 Weeks
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Lamin A (LMNA) mouse monoclonal antibody, clone R27, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Fish, Human, Mouse, Rat, Xenopus, Zebrafish |
TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Supernatant
| Applications | IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-TPM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM2 antibody: synthetic peptide directed towards the C terminal of human TPM2. Synthetic peptide located within the following region: AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit polyclonal anti-MYBPC3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MYBPC3. |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Anti-Human IGF-I Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IGF-I |
USD 230.00
2 Weeks
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Rabbit anti-IGF1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IGF1 |
TPM1 (Sarcomeric) mouse monoclonal antibody, clone ST-39, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Rabbit, Rat |
beta Actin (ACTB) mouse monoclonal antibody, clone AC-15, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
USD 390.00
2 Weeks
Integrin alpha 3 (ITGA3) (3A Isoform specific) mouse monoclonal antibody, clone 29A3, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
USD 390.00
2 Weeks
Active filters
Applications
- IHC
Pathways
- Dilated cardiomyopathy
Filter by
Category
Target Symbol
- TNNT2 (38)
- DES (34)
- GNAS (32)
- TNNI3 (32)
- TNNC1 (24)
- ITGB3 (23)
- TNF (19)
- IGF1 (16)
- SHC1 (16)
- LMNA (10)
- ACTB (9)
- ITGA6 (8)
- TPM2 (7)
- ITGB1 (6)
- TGFB1 (6)
- TPM1 (6)
- ITGA3 (5)
- SGCD (5)
- CACNA1C (4)
- DMD (4)
- ITGA4 (4)
- ITGB4 (4)
- TGFB3 (4)
- ADCY1 (3)
- ADCY5 (3)
- ITGA2 (3)
- ITGA2B (3)
- MYH7 (3)
- MYL2 (3)
- ACTC1 (2)
- ACTG1 (2)
- ADCY4 (2)
- CACNA2D2 (2)
- CACNB1 (2)
- EMD (2)
- ITGA5 (2)
- ITGA7 (2)
- ITGAV (2)
- MYBPC3 (2)
- PRKACA (2)
- PRKACG (2)
- PRKX (2)
- RYR2 (2)
- TGFB2 (2)
- ADCY3 (1)
- ADCY6 (1)
- ADCY7 (1)
- ADCY8 (1)
- ADRB1 (1)
- ATP2A2 (1)
- CACNA1D (1)
- CACNA1S (1)
- CACNB2 (1)
- CACNG5 (1)
- CACNG6 (1)
- CACNG8 (1)
- ITGA1 (1)
- ITGA11 (1)
- ITGA8 (1)
- ITGB5 (1)
- ITGB6 (1)
- ITGB7 (1)
- LAMA2 (1)
- MYL3 (1)
- PRKACB (1)
- SGCA (1)
- SGCB (1)