Germany
Japan
United Kingdom
China
USD 420.00
In Stock
Products
Download
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
USD 750.00
In Stock
Rabbit Polyclonal Anti-CPE Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal Anti-TINAGL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TINAGL1 antibody: synthetic peptide directed towards the middle region of human TINAGL1. Synthetic peptide located within the following region: NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Goat Anti-APOL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NNNYKILQADQE, from the C Terminus of the protein sequence according to NP_003652.2; NP_663318.1. |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Rabbit Polyclonal Anti-MGP
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGP antibody: synthetic peptide directed towards the middle region of human MGP. Synthetic peptide located within the following region: INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM |
Rabbit Polyclonal Anti-RFX1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RFX1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human RFX1. The immunogen is located within the last 50 amino acids of RFX1. |
Active filters
Applications
- WB
Families
- Secreted Protein
Filter by
Target Symbol
- KLK8 (243)
- EGFR (156)
- LIPG (128)
- MSMB (120)
- ADIPOQ (105)
- CFI (104)
- AFP (102)
- VWF (91)
- LGALS3 (90)
- LOX (72)
- FGF21 (71)
- F13A1 (69)
- CHGA (63)
- SYP (63)
- CD40 (60)
- FGG (58)
- CD163 (57)
- CSF3 (57)
- AGR2 (55)
- SERPINB3 (53)
- APOE (52)
- ERBB3 (51)
- KLK3 (51)
- FGFR2 (50)
- SERPINA5 (50)
- CSF2 (49)
- HP (48)
- MUC1 (48)
- NPPB (48)
- VEGFA (48)
- FSHB (47)
- WNT3 (47)
- GNAS (46)
- IL20 (46)
- RAB37 (46)
- CPA1 (45)
- CRP (45)
- MSLN (45)
- REN (44)
- ACE2 (43)
- TIMP2 (43)
- ALB (42)
- SERPINA1 (42)
- SERPINB4 (42)
- IL1RN (41)
- RNASE11 (41)
- SYT4 (41)
- FCER2 (39)
- TFPI (38)
- TNF (38)
- VIP (38)
- APOA5 (37)
- PMEL (37)
- SPP1 (37)
- TFPI2 (37)
- TNFRSF18 (37)
- CALR (36)
- LGALS3BP (36)
- P3H1 (35)
- SERPINB2 (34)
- CPA2 (33)
- PON3 (33)
- PRL (33)
- IGFBP1 (32)
- IL1A (32)
- LAMB3 (32)
- APOL1 (31)
- CST2 (31)
- IL6 (31)
- PROZ (31)
- POSTN (30)
- SIL1 (30)
- GRN (29)
- WFDC2 (29)
- ERAP1 (28)
- MASP2 (28)
- SERPINE2 (28)
- STX1A (28)
- CCN2 (27)
- IGF1 (27)
- IL24 (27)
- MGP (27)
- MSTN (27)
- SPINT1 (27)
- FGF2 (26)
- HBEGF (26)
- IFNG (26)
- MTMR14 (26)
- PON1 (26)
- BMP6 (25)
- CSF1 (25)
- CSF2RA (25)
- FGFBP1 (25)
- IL17B (25)
- NTF3 (24)
- TFF1 (24)
- VEGFB (24)
- VEGFD (24)
- APOH (23)
- CHIA (23)
Reactivities
- Human (7663)
- Mouse (2439)
- Rat (1996)
- Dog (194)
- Monkey (124)
- Pig (50)
- Bovine (46)
- Cow (37)
- Primate (17)
- Chicken (16)
- Rabbit (16)
- Canine (12)
- Porcine (11)
- Hamster (6)
- Rhesus Monkey (5)
- Chimpanzee (4)
- Equine (4)
- Sheep (4)
- Zebrafish (4)
- Guinea Pig (3)
- Xenopus (3)
- Horse (2)
- Macaque (2)
- Opossum (2)
- Amphibian (1)
- Drosophila (1)
- Feline (1)
- Fish (1)
- Goat (1)
- SimianIVE (1)
Antibody Hosts
Isotypes
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Cytokine-cytokine receptor interaction (1506)
- Pathways in cancer (955)
- Complement and coagulation cascades (685)
- Jak-STAT signaling pathway (625)
- MAPK signaling pathway (601)
- Focal adhesion (552)
- Hematopoietic cell lineage (444)
- Regulation of actin cytoskeleton (429)
- Melanoma (359)
- GnRH signaling pathway (312)
- Metabolic pathways (306)
- Toll-like receptor signaling pathway (304)
- Bladder cancer (301)
- Pancreatic cancer (300)
- Prostate cancer (296)
- Endocytosis (293)
- ErbB signaling pathway (255)
- Calcium signaling pathway (253)
- ECM-receptor interaction (236)
- Allograft rejection (235)
- TGF-beta signaling pathway (228)
- Epithelial cell signaling in Helicobacter pylori infection (220)
- Gap junction (208)
- Systemic lupus erythematosus (201)
- Type I diabetes mellitus (199)
- Graft-versus-host disease (189)
- Hedgehog signaling pathway (187)
- Glioma (186)
- T cell receptor signaling pathway (186)
- Colorectal cancer (184)
- Asthma (183)
- PPAR signaling pathway (182)
- Natural killer cell mediated cytotoxicity (177)
- Adipocytokine signaling pathway (176)
- Autoimmune thyroid disease (163)
- Chemokine signaling pathway (161)
- Melanogenesis (159)
- Non-small cell lung cancer (159)
- NOD-like receptor signaling pathway (158)
- Adherens junction (156)
- Dorso-ventral axis formation (156)
- Endometrial cancer (156)
- Neuroactive ligand-receptor interaction (152)
- Fc epsilon RI signaling pathway (151)
- Glycerolipid metabolism (150)
- Basal cell carcinoma (146)
- Type II diabetes mellitus (146)
- Renal cell carcinoma (144)
- mTOR signaling pathway (143)
- Apoptosis (142)
- Hypertrophic cardiomyopathy (HCM) (142)
- Dilated cardiomyopathy (141)
- Wnt signaling pathway (139)
- Alzheimer's disease (135)
- Prion diseases (134)
- RIG-I-like receptor signaling pathway (131)
- Renin-angiotensin system (118)
- Cytosolic DNA-sensing pathway (109)
- Long-term depression (103)
- Antigen processing and presentation (98)
- p53 signaling pathway (91)
- Small cell lung cancer (87)
- Cell adhesion molecules (CAMs) (85)
- Primary immunodeficiency (85)
- VEGF signaling pathway (74)
- Vascular smooth muscle contraction (72)
- Viral myocarditis (68)
- Axon guidance (59)
- Neurotrophin signaling pathway (59)
- Amyotrophic lateral sclerosis (ALS) (53)
- Regulation of autophagy (50)
- Taste transduction (46)
- Vibrio cholerae infection (46)
- Cell cycle (36)
- SNARE interactions in vesicular transport (33)
- Arachidonic acid metabolism (31)
- Oocyte meiosis (30)
- Progesterone-mediated oocyte maturation (30)
- Chronic myeloid leukemia (28)
- Ether lipid metabolism (28)
- Glycerophospholipid metabolism (26)
- Linoleic acid metabolism (26)
- Proteasome (26)
- alpha-Linolenic acid metabolism (26)
- Amino sugar and nucleotide sugar metabolism (25)
- Fc gamma R-mediated phagocytosis (24)
- Histidine metabolism (24)
- Starch and sucrose metabolism (22)
- beta-Alanine metabolism (18)
- Leukocyte transendothelial migration (13)
- Purine metabolism (10)
- Pyrimidine metabolism (10)
- Glycosaminoglycan degradation (9)
- Huntington's disease (8)
- Acute myeloid leukemia (7)
- Tyrosine metabolism (7)
- Arginine and proline metabolism (6)
- Pathogenic Escherichia coli infection (6)
- Tryptophan metabolism (6)
- Folate biosynthesis (5)
- Glutathione metabolism (5)
- Glycosphingolipid biosynthesis - lacto and neolacto series (5)
- Maturity onset diabetes of the young (5)
- N-Glycan biosynthesis (5)
- Keratan sulfate biosynthesis (4)
- O-Glycan biosynthesis (4)
- Riboflavin metabolism (4)
- Insulin signaling pathway (3)
- Nitrogen metabolism (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Galactose metabolism (2)
- Glycosphingolipid biosynthesis - ganglio series (2)
- Glycosphingolipid biosynthesis - globo series (2)
- Lysosome (2)
- Other glycan degradation (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)