Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Goat Polyclonal Anti-Vimentin Antibody
| Applications | FC, IF, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Goat Polyclonal Anti-Aconitase 2 (aa541-555) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aconitase 2 (aa541-555) Antibody: Peptide with sequence C-QDTYQHPPKDSSGQH, from the internal region of the protein sequence according to NP_001089.1. |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Goat Polyclonal Antibody against HPS6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence LRTELRDYRGLEC, from the internal region of the protein sequence according to NP_079023. |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal GC Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC. |
Rabbit Polyclonal Anti-OAT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OAT antibody: synthetic peptide directed towards the C terminal of human OAT. Synthetic peptide located within the following region: VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
Goat Polyclonal Anti-PCNA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCNA Antibody: Peptide with sequence C-NGNIKLSQTSNVD, from the internal region of the protein sequence according to NP_002583.1. |
Goat Polyclonal Anti-IDH3B (aa33-46) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3B (aa33-46) Antibody: Peptide with sequence C-HAASRSQAEDVRVE, from the internal region (near N Terminus) of the protein sequence according to NP_008830.2; NP_777280.1. |
Goat Polyclonal Anti-IDH3A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3A Antibody: Peptide with sequence DFTEEICRRVKDLD, from the C Terminus of the protein sequence according to NP_005521.1. |
Goat Polyclonal Anti-CDH1 (aa662-675) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDH1 (aa662-675) Antibody: Peptide with sequence C-DYKINLKLMDNQNK, from the internal region of the protein sequence according to NP_004351.1. |
Goat Polyclonal Antibody against PRPF31
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KELGNSLDKCKNNEN, from the internal region of the protein sequence according to NP_056444.2. |
Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093) |
Goat Polyclonal Antibody against KLF3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence LMFDPVPVKQEAMD-C, from the N Terminus of the protein sequence according to NP_057615. |
Goat Anti-ERN1 / IRE1a Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PNAHGKIKAMISD, from the internal region of the protein sequence according to NP_001424.3. |
Rabbit Polyclonal antibody to VCP (valosin-containing protein)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of VCP (Uniprot ID#P55072) |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-DEFB129 Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DEFB129 antibody is: synthetic peptide directed towards the C-terminal region of Human DEFB129. Synthetic peptide located within the following region: TSFFANTNFVIIPNATPMNSATISTMTPGQITYTATSTKSNTKESRDSAT |
Goat Polyclonal Anti-PRDM1 / MEL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PRDM1 / MEL1 Antibody: Peptide with sequence C-DISDNADRLEDVED, from the internal region of the protein sequence according to NP_001189.2; NP_878911.1. |
Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 223 and 502 of O-GlcNAc transferase (Uniprot ID#O15294) |
Goat Polyclonal Anti-cardiac troponin T (aa201-213) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Feline, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-cardiac troponin T (aa201-213) Antibody: Peptide with sequence C-TERKSGKRQTERE, from the internal region of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
Goat Polyclonal Anti-Hdac1 (aa385-396) Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hdac1 (aa385-396) Antibody: Peptide with sequence C-PEDAIPEESGDE, from the internal region of the protein sequence according to NP_032254.1. |
Goat Polyclonal Anti-MDH1 / MOR2 (aa211-223) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MDH1 / MOR2 (aa211-223) Antibody: Peptide with sequence C-PDVNHAKVKLQGK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1. |
Goat Polyclonal Anti-HOXA5 (aa83-92) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HOXA5 (aa83-92) Antibody: Peptide with sequence C-EPRYSQPATS, from the internal region of the protein sequence according to NP_061975.2. |
Active filters
Reactivities
- Pig
Applications
- WB
Isotypes
- IgG
Filter by
Category
Target Symbol
- ACTA1 (3)
- CFL2 (3)
- DCN (3)
- DUSP6 (3)
- FTCD (3)
- SMAD3 (3)
- STK26 (3)
- ADAP1 (2)
- AIF1 (2)
- AIRE (2)
- ANXA1 (2)
- APEX1 (2)
- APP (2)
- CAPZB (2)
- CKB (2)
- CLDN14 (2)
- FOXP2 (2)
- FYN (2)
- GAD2 (2)
- GAPDH (2)
- GNAS (2)
- GOT2 (2)
- GPR4 (2)
- GPX2 (2)
- H2AFZ (2)
- HNF1A (2)
- HOXA5 (2)
- HPRT1 (2)
- HPS3 (2)
- HPS6 (2)
- HSP90B1 (2)
- JUN (2)
- JUP (2)
- MDH1 (2)
- NQO1 (2)
- NRAS (2)
- OGT (2)
- PCBP2 (2)
- PSMB8 (2)
- PTBP1 (2)
- RAE1 (2)
- RXRB (2)
- SEC61A1 (2)
- SMAD4 (2)
- SYK (2)
- TBP (2)
- TP53 (2)
- TPT1 (2)
- AAPK1 (1)
- ABCC5 (1)
- ACAD8 (1)
- ACAP2 (1)
- ACO2 (1)
- ACTC1 (1)
- ACTL6B (1)
- ACTN1 (1)
- ACTR1A (1)
- ACY1 (1)
- ADAM12 (1)
- ADAM19 (1)
- ADCYAP1 (1)
- ADH5 (1)
- ADRA1A (1)
- ADRA1B (1)
- AICDA (1)
- AKAP3 (1)
- AKR1A1 (1)
- AMPH (1)
- AMY1A (1)
- ANP32B (1)
- ANXA2 (1)
- APH1A (1)
- AR (1)
- ARAF (1)
- ARF3 (1)
- ARF5 (1)
- ARG1 (1)
- ARL4A (1)
- ARNTL (1)
- ARPC1B (1)
- ARPC2 (1)
- ASIC1 (1)
- ASPA (1)
- ATF4 (1)
- ATG5 (1)
- ATIC (1)
- ATP5F1A (1)
- ATP5F1B (1)
- ATP6V1H (1)
- ATXN3 (1)
- BAALC (1)
- BAG2 (1)
- BAK1 (1)
- BCAP31 (1)
- BCAR3 (1)
- BCL7A (1)
- BHMT (1)
- BIN1 (1)
- BIRC5 (1)
- BIVM (1)
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (306)
- Transcription Factors (81)
- Transmembrane (71)
- ES Cell Differentiation/IPS (37)
- Secreted Protein (36)
- Stem cell - Pluripotency (33)
- Protein Kinase (24)
- Protease (21)
- Nuclear Hormone Receptor (11)
- Phosphatase (11)
- Adult stem cells (9)
- Embryonic stem cells (9)
- GPCR (9)
- Stem cell relevant signaling - JAK/STAT signaling pathway (9)
- Cancer stem cells (8)
- Ion Channels: Other (5)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (5)
- Stem cell relevant signaling - Wnt Signaling pathway (4)
- Ion Channels: Transient receptor potential (3)
- Induced pluripotent stem cells (2)
- Ion Channels: Cys-loop Receptors (1)
Pathways
- Metabolic pathways (71)
- Pathways in cancer (37)
- Wnt signaling pathway (23)
- MAPK signaling pathway (20)
- Huntington's disease (16)
- Chronic myeloid leukemia (15)
- Colorectal cancer (15)
- Prostate cancer (15)
- Regulation of actin cytoskeleton (15)
- Cell cycle (14)
- Focal adhesion (14)
- Neurotrophin signaling pathway (14)
- Alzheimer's disease (13)
- Insulin signaling pathway (13)
- TGF-beta signaling pathway (13)
- Acute myeloid leukemia (12)
- Fc gamma R-mediated phagocytosis (12)
- Leukocyte transendothelial migration (12)
- Natural killer cell mediated cytotoxicity (12)
- Adherens junction (11)
- Arginine and proline metabolism (11)
- Axon guidance (11)
- Chemokine signaling pathway (11)
- Citrate cycle (TCA cycle) (11)
- Glycolysis / Gluconeogenesis (11)
- Pancreatic cancer (11)
- T cell receptor signaling pathway (11)
- Tight junction (11)
- Adipocytokine signaling pathway (10)
- B cell receptor signaling pathway (10)
- Endocytosis (10)
- ErbB signaling pathway (10)
- Fc epsilon RI signaling pathway (10)
- Melanogenesis (10)
- Pathogenic Escherichia coli infection (10)
- Thyroid cancer (10)
- Bladder cancer (9)
- Endometrial cancer (9)
- Jak-STAT signaling pathway (9)
- Non-small cell lung cancer (9)
- Parkinson's disease (9)
- Epithelial cell signaling in Helicobacter pylori infection (8)
- GnRH signaling pathway (8)
- Oocyte meiosis (8)
- PPAR signaling pathway (8)
- Small cell lung cancer (8)
- Vascular smooth muscle contraction (8)
- Alanine (7)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (7)
- Calcium signaling pathway (7)
- Cell adhesion molecules (CAMs) (7)
- Dilated cardiomyopathy (7)
- Gap junction (7)
- Glioma (7)
- Melanoma (7)
- Neuroactive ligand-receptor interaction (7)
- Oxidative phosphorylation (7)
- Renal cell carcinoma (7)
- Systemic lupus erythematosus (7)
- Ubiquitin mediated proteolysis (7)
- aspartate and glutamate metabolism (7)
- Basal cell carcinoma (6)
- Cysteine and methionine metabolism (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- Long-term depression (6)
- Long-term potentiation (6)
- One carbon pool by folate (6)
- Phenylalanine metabolism (6)
- Primary immunodeficiency (6)
- Pyruvate metabolism (6)
- Tyrosine metabolism (6)
- Antigen processing and presentation (5)
- Apoptosis (5)
- Cardiac muscle contraction (5)
- Cytokine-cytokine receptor interaction (5)
- Glutathione metabolism (5)
- Histidine metabolism (5)
- Lysosome (5)
- Maturity onset diabetes of the young (5)
- Prion diseases (5)
- Proteasome (5)
- Purine metabolism (5)
- Spliceosome (5)
- Toll-like receptor signaling pathway (5)
- Vibrio cholerae infection (5)
- Viral myocarditis (5)
- p53 signaling pathway (5)
- Amyotrophic lateral sclerosis (ALS) (4)
- Arachidonic acid metabolism (4)
- Complement and coagulation cascades (4)
- Drug metabolism - cytochrome P450 (4)
- Glycerolipid metabolism (4)
- Glyoxylate and dicarboxylate metabolism (4)
- NOD-like receptor signaling pathway (4)
- Progesterone-mediated oocyte maturation (4)
- Ribosome (4)
- Amino sugar and nucleotide sugar metabolism (3)
- Base excision repair (3)
- Butanoate metabolism (3)
- Fructose and mannose metabolism (3)
- Glycerophospholipid metabolism (3)
- Glycine (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- Pyrimidine metabolism (3)
- Regulation of autophagy (3)
- Taurine and hypotaurine metabolism (3)
- Type I diabetes mellitus (3)
- Type II diabetes mellitus (3)
- VEGF signaling pathway (3)
- beta-Alanine metabolism (3)
- serine and threonine metabolism (3)
- Basal transcription factors (2)
- Biosynthesis of unsaturated fatty acids (2)
- Drug metabolism - other enzymes (2)
- Galactose metabolism (2)
- Hedgehog signaling pathway (2)
- Limonene and pinene degradation (2)
- Lysine degradation (2)
- Methane metabolism (2)
- Notch signaling pathway (2)
- O-Glycan biosynthesis (2)
- Phenylalanine (2)
- Propanoate metabolism (2)
- RIG-I-like receptor signaling pathway (2)
- Sphingolipid metabolism (2)
- Starch and sucrose metabolism (2)
- Taste transduction (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- tyrosine and tryptophan biosynthesis (2)
- ABC transporters (1)
- Allograft rejection (1)
- Androgen and estrogen metabolism (1)
- Asthma (1)
- Autoimmune thyroid disease (1)
- Circadian rhythm - mammal (1)
- Cytosolic DNA-sensing pathway (1)
- DNA replication (1)
- Fatty acid biosynthesis (1)
- Fatty acid metabolism (1)
- Glycosaminoglycan degradation (1)
- Hematopoietic cell lineage (1)
- Inositol phosphate metabolism (1)
- Lipoic acid metabolism (1)
- Mismatch repair (1)
- N-Glycan biosynthesis (1)
- Nitrogen metabolism (1)
- Nucleotide excision repair (1)
- Olfactory transduction (1)
- Other glycan degradation (1)
- Pentose phosphate pathway (1)
- Phosphatidylinositol signaling system (1)
- RNA polymerase (1)
- Renin-angiotensin system (1)
- Retinol metabolism (1)
- Sulfur metabolism (1)
- Tryptophan metabolism (1)
- mTOR signaling pathway (1)