Germany
Japan
United Kingdom
China
Factor H (CFH) mouse monoclonal antibody, clone OX-24, Purified
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Human |
Products
View as table Download
CD46 mouse monoclonal antibody, clone AT2G9, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
CD46 mouse monoclonal antibody, clone AT2G9, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
Complement C3 (C3) chicken polyclonal antibody, HRP
| Applications | ELISA, FC, WB |
| Reactivities | Human |
| Conjugation | HRP |
| Immunogen | Purified Human Complement Component 3a (C3a) peptide. |
Factor I (CFI) mouse monoclonal antibody, clone OX-21, Biotin
| Applications | ELISA, FC, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
Factor I (CFI) mouse monoclonal antibody, clone OX-21, FITC
| Applications | ELISA, FC, IP, R, WB |
| Reactivities | Human |
| Conjugation | FITC |
Rabbit polyclonal antibody to Factor XIIIa (coagulation factor XIII, A1 polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 258 of Factor XIIIa (Uniprot ID#P00488) |
Anti-FGB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 290 amino acids of human fibrinogen beta chain |
Rabbit polyclonal C1QC Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC. |
Rabbit polyclonal SERPINE1 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SERPINE1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-216 amino acids from the Central region of human SERPINE1. |
Rabbit polyclonal C1QB Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This C1QB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 55-81 amino acids from the N-terminal region of human C1QB. |
Rabbit anti-F9 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F9 |
Rabbit anti-KLKB1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KLKB1 |
Rabbit anti-SERPIND1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPIND1 |
Rabbit Polyclonal Anti-SERPIND1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPIND1 antibody: synthetic peptide directed towards the middle region of human SERPIND1. Synthetic peptide located within the following region: VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ |
Rabbit Polyclonal Anti-C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ |
Rabbit Polyclonal Anti-C8G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C8G antibody is: synthetic peptide directed towards the N-terminal region of Human C8G. Synthetic peptide located within the following region: VGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGD |
Rabbit Polyclonal Anti-F13B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F13B antibody: synthetic peptide directed towards the middle region of human F13B. Synthetic peptide located within the following region: LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP |
Goat Polyclonal Anti-fibrinogen alpha chain (aa123-135) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-fibrinogen alpha chain (aa123-135) Antibody: Peptide with sequence C-RDNTYNRVSEDLR, from the internal region of the protein sequence according to NP_000499.1; NP_068657.1. |
USD 745.00
5 Days
Complement factor B (CFB) (Bb Fragment) mouse monoclonal antibody, clone 032B-22.1.X, Purified
| Applications | ELISA, FC, WB |
| Reactivities | Human |
Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone AD-1, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
Complement C5 (C5) (N-term) rabbit polyclonal antibody
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 253-281 amino acids from the N-terminal region of human C5. |
alpha 1 Antitrypsin (SERPINA1) (Center) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 165~195 amino acids from the Central region of Human SERPINA1. |
Complement C4A (C4A) mouse monoclonal antibody, clone 10-11, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
Complement C5 (C5) mouse monoclonal antibody, clone HCC5.1, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Rabbit polyclonal anti-C1S antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human C1S.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. |
Rabbit polyclonal anti-uPAR antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 51 of rat uPAR |
Goat polyclonal Plasminogen antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen [Human Plasma] |
Rabbit polyclonal CD46 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD46 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-343 amino acids from the C-terminal region of human CD46. |
Rabbit polyclonal SERPINC1 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SERPINC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human SERPINC1. |
A2M Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human A2M |
Rabbit anti-SERPINC1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPINC1 |
Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal. |
Rabbit anti-TFPI Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFPI |
Rabbit anti-FGG Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FGG |
Active filters
Applications
- WB
Pathways
- Complement and coagulation cascades
Filter by
Category
Target Symbol
- CFI (104)
- VWF (91)
- F13A1 (69)
- FGG (58)
- SERPINA5 (50)
- SERPINA1 (42)
- TFPI (38)
- C1S (31)
- MASP2 (28)
- F10 (23)
- C6 (22)
- PLAU (20)
- F13B (17)
- F2 (17)
- F12 (16)
- C1R (14)
- C2 (14)
- C3 (13)
- F7 (12)
- F2R (11)
- MBL2 (11)
- SERPINC1 (11)
- CFH (10)
- FGB (10)
- PLAT (10)
- PLG (10)
- KNG1 (9)
- A2M (8)
- CD59 (8)
- CD46 (7)
- FGA (7)
- PROC (7)
- SERPINE1 (7)
- C4B (6)
- CD55 (6)
- CFB (6)
- CR1 (6)
- F9 (6)
- BDKRB1 (5)
- C5 (5)
- C9 (5)
- KLKB1 (5)
- SERPING1 (5)
- BDKRB2 (4)
- C1QB (4)
- PLAUR (4)
- PROS1 (4)
- SERPINF2 (4)
- C1QA (3)
- C4A (3)
- C5AR1 (3)
- CFD (3)
- CPB2 (3)
- F11 (3)
- C1QC (2)
- C3AR1 (2)
- C7 (2)
- C8B (2)
- F8 (2)
- MASP1 (2)
- SERPIND1 (2)
- THBD (2)
- C4BPA (1)
- C4BPB (1)
- C8G (1)
- CR2 (1)
- F3 (1)