Germany
Japan
United Kingdom
China
Products
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Drosophila) |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
CD11b (ITGAM) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to a sequence shared between the Mouse (NP_001076429.1) and Human gene products (NP_001139280.1). After repeated injections, immune eggs were collected, and the IgY fractions were purified from the yolks. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Active filters
Category
-
- Antibodies
-
Pathways
- Regulation of actin cytoskeleton
Filter by
Target Symbol
- MAP2K1 (237)
- EGFR (207)
- BRAF (100)
- FGF21 (75)
- MAPK1 (74)
- FGFR2 (66)
- LIMK1 (64)
- PIK3CG (64)
- PDGFRA (63)
- KRAS (58)
- PDGFRB (50)
- PXN (49)
- CD14 (47)
- HRAS (47)
- PIK3R5 (47)
- FGFR1 (43)
- PTK2 (41)
- ACTB (38)
- EGF (38)
- ITGB3 (37)
- PIK3CD (35)
- MAP2K2 (34)
- RAF1 (33)
- SHC1 (32)
- FGF2 (31)
- FN1 (31)
- BCAR1 (30)
- EZR (29)
- BAIAP2 (27)
- ITGB1 (27)
- MYL7 (26)
- PAK1 (26)
- PIK3CA (25)
- ARAF (24)
- CFL1 (23)
- MAPK3 (23)
- PIKFYVE (23)
- PAK4 (22)
- IQGAP1 (21)
- ITGAM (21)
- WASL (21)
- APC (20)
- PIP4K2A (19)
- INS (18)
- F2 (17)
- FGFR3 (17)
- NRAS (17)
- ARHGEF4 (16)
- PDGFB (16)
- PFN1 (16)
- ACTN1 (15)
- ROCK2 (15)
- F2R (14)
- PIK3R1 (14)
- VCL (14)
- FGF1 (13)
- FGF13 (13)
- FGF4 (13)
- ITGA6 (13)
- ITGAV (13)
- NCF1 (12)
- PPP1CA (12)
- ITGA4 (11)
- ITGAX (11)
- LIMK2 (11)
- PDGFA (11)
- ITGAL (10)
- VAV1 (10)
- ITGA2 (9)
- ITGA5 (9)
- MYL9 (9)
- RHOA (9)
- ACTN2 (8)
- CHRM1 (8)
- CRK (8)
- CSK (8)
- GSN (8)
- ITGB4 (8)
- MSN (8)
- PAK2 (8)
- RRAS (8)
- ACTG1 (7)
- BDKRB1 (7)
- CRKL (7)
- ITGA3 (7)
- ITGAE (7)
- ITGB2 (7)
- PAK5 (7)
- PPP1CB (7)
- PPP1CC (7)
- ROCK1 (7)
- ACTN3 (6)
- ACTN4 (6)
- FGF7 (6)
- ITGB5 (6)
- ITGB6 (6)
- MYH9 (6)
- MYL2 (6)
- PDGFD (6)
- RAC1 (6)
Reactivities
- Human (2505)
- Mouse (2004)
- Rat (1901)
- Dog (366)
- Monkey (350)
- Bovine (39)
- Chicken (34)
- Pig (23)
- Cow (14)
- Rabbit (14)
- Rhesus Monkey (12)
- Xenopus (11)
- Canis (8)
- Drosophila (8)
- Hamster (7)
- Canine (6)
- Horse (6)
- Zebrafish (5)
- Porcine (4)
- X. tropicalis (4)
- Bat (3)
- Chimpanzee (3)
- Gorilla (3)
- Primate (3)
- Baboon (2)
- Guinea Pig (2)
- Orang-Utan (2)
- Sheep (2)
- All Species (1)
- Avian (1)
- Broad (1)
- C. elegans (1)
- Gibbon (1)
- Goat (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2653)
- Protein Kinase (1208)
- ES Cell Differentiation/IPS (856)
- Transmembrane (816)
- Secreted Protein (550)
- Adult stem cells (397)
- Cancer stem cells (207)
- Stem cell relevant signaling - JAK/STAT signaling pathway (207)
- Embryonic stem cells (190)
- Stem cell - Pluripotency (100)
- Induced pluripotent stem cells (56)
- GPCR (44)
- Phosphatase (28)
- Transcription Factors (23)
- Protease (17)
- Stem cell relevant signaling - Wnt Signaling pathway (13)