Products

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.

USD 320.00

In Stock

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.

USD 450.00

In Stock

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit Polyclonal Anti-MAPK7 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAPK7

Rabbit anti-PRKCA Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human PRKCA

Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control

Applications WB
Reactivities Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437.

Rabbit Polyclonal Anti-TUBA4A Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE

Rabbit Polyclonal Anti-GRB2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit anti-PDGFB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDGFB

Phospho-PRKCB-T641 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T641 of human PRKCB
Modifications Phospho-specific

Rabbit Polyclonal Anti-RAF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RAF1

Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human
Conjugation Unconjugated
Immunogen DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%).

PLCB1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PLCB1

MAPK7 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAPK7

Rabbit Polyclonal Anti-UVRAG Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen UVRAG antibody was raised against an 18 amino acid peptide near the carboxy terminus of human UVRAG.

Rabbit anti-CDK1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK1

Rabbit Polyclonal Anti-TJP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS

Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD

Rabbit Polyclonal Anti-TUBB2A Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV

Rabbit Polyclonal Anti-GNAS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ

USD 320.00

In Stock

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.

Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%).

Rabbit anti-PRKACB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKACB

Phospho-CDK1-T161 Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T161 of human CDK1
Modifications Phospho-specific

Rabbit Polyclonal Anti-MAP2K1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAP2K1

Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 296 of ZO-1 (Uniprot ID#Q07157)

Rabbit Polyclonal antibody to beta Tubulin (tubulin, beta)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 238 and 429 of beta Tubulin

Rabbit anti-MEK1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human MEK1

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Phospho-SRC-Y418 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y418 of human SRC
Modifications Phospho-specific

Rabbit Polyclonal Anti-TUBB2A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC

USD 300.00

In Stock

Goat Polyclonal Anti-TUBA4A Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 400 aa to the C-terminus of human alpha tubulin produced in E. coli.

Rabbit polyclonal SOS2 Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2.

Rabbit anti-PDGFRB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDGFRB

Rabbit anti-GNAS Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GNAS

Rabbit Polyclonal Anti-TUBB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB4 antibody: synthetic peptide directed towards the N terminal of human TUBB4. Synthetic peptide located within the following region: TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI

Rabbit Polyclonal Anti-ADCY6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY

Rabbit Polyclonal NRAS Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612)

Rabbit polyclonal anti-TUBA4A(alpha Tubulin) antibody, Loading control

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 21 and 243 of alpha Tubulin 4a (Uniprot ID#P68366)

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2)

Rabbit polyclonal Connexin 43 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Connexin 43.
Modifications Phospho-specific

Rabbit polyclonal anti-PDGFR a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PDGFR a.

Rabbit polyclonal NRAS Antibody (N-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS.

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit Polyclonal Anti-TUBB2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB2B antibody is: synthetic peptide directed towards the N-terminal region of Human TUBB2B. Synthetic peptide located within the following region: GGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSV

Rabbit Polyclonal Anti-TUBB6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB6 antibody: synthetic peptide directed towards the N terminal of human TUBB6. Synthetic peptide located within the following region: QLERINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIF