CD36 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3F4
Applications | ELISA, LMNX |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700031 |
CD36 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3F4
Applications | ELISA, LMNX |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700031 |
Anti-CD36 mouse mAb, clone OTI4H7, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Anti-CD36 mouse mAb, clone OTI3F4, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-CD36 mouse mAb, clone OTI3F4, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Anti-CD36 mouse mAb, clone OTI4H7, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
Rabbit anti-CPT1A Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CPT1A |
Rabbit Polyclonal Anti-ACSL3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
Goat Polyclonal Antibody against CPT1A
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1. |
Mouse anti-SCD1 (Stearoyl-CoA desaturase) monoclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit Polyclonal Antibody against CD36
Applications | IHC, WB |
Reactivities | Human, Bovine, Monkey |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide mapping to a region of human CD36 between residues 100-200. |
SCD5 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 147-175 amino acids from the Central region of Human SCD5 |
Rabbit Polyclonal Anti-CYP4A22 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
FADS2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of Human FADS2 |
Rabbit Polyclonal Anti-SCD Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG |
Rabbit Polyclonal Anti-CPT1B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA |
SCD1 (SCD) mouse monoclonal antibody, clone CD.E10, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human, Mouse |
Goat Anti-CPT1C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KSSTKTDSHRLGQH, from the internal region of the protein sequence according to NP_689572.1; NP_001129524.1. |
Rabbit polyclonal anti-SLC27A5 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC27A5. |
Rabbit polyclonal anti-SLC27A4 antibody
Applications | IF |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC27A4. |
Rabbit anti-OLR1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human OLR1 |
Rabbit anti-CD36 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD36 |
Rabbit polyclonal anti-CPT1B antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CPT1B. |
Rabbit Polyclonal Anti-ACSL6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACSL6 antibody is: synthetic peptide directed towards the middle region of Human ACSL6. Synthetic peptide located within the following region: GPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFE |
Rabbit Polyclonal Anti-SLC27A5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC27A5 antibody: synthetic peptide directed towards the middle region of human SLC27A5. Synthetic peptide located within the following region: KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD |
Rabbit Polyclonal Anti-ACSL6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACSL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ACSL6. Synthetic peptide located within the following region: SGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYS |
Rabbit Polyclonal Anti-CYP4A22 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS |
SCD1 (SCD) (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, FC, IHC |
Reactivities | Human |
Immunogen | Peptide with sequence C-RIKRTGDGNYKSG, from the C Terminus of the protein sequence according to NP_005054.3. |
CPT1A (621-634) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human CPT1A |
Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928) |
Rabbit polyclonal Cytochrome P450 4A11/22 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYTOCHROME P450 4A11/22. |
Rabbit polyclonal anti-LOX-1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide near the N-terminus of human Lox-1 |
Rabbit polyclonal FADS2 Antibody (Center)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FADS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 96-122 amino acids from the Central region of human FADS2. |
Rabbit polyclonal CYP8B1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
Rabbit Polyclonal Anti-ACSL1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the N terminal of human ACSL1. Synthetic peptide located within the following region: ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY |
Rabbit Polyclonal Anti-SLC27A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC27A2 Antibody: synthetic peptide directed towards the N terminal of human SLC27A2. Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW |
Rabbit Polyclonal Anti-ACSL5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACSL5 antibody: synthetic peptide directed towards the C terminal of human ACSL5. Synthetic peptide located within the following region: ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG |
Rabbit Polyclonal SCD5 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
CD36 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6A5
Applications | ELISA, LMNX |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700031 |
USD 530.00
2 Weeks
LOX 1 (OLR1) (sLOX-1) mouse monoclonal antibody, clone LOX19-22
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CPT1B (760-772) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human |
Immunogen | Synthetic peptide from C-term of human CPT1B |
SCD1 (SCD) (354-366) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human |
Immunogen | Synthetic peptide from C-terminus of human SCD |
CPT1C (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 759-790 amino acids from the C-terminal region of human CPT1C |
Rabbit Polyclonal Antibody against CD36
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide mapping to a region of human CD36 between residues 300-400. |
Rabbit polyclonal anti-FATP4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 598 of rat FATP4 |
Rabbit polyclonal anti-SCD (stearoyl-CoA desaturase) antibody
Applications | WB |
Reactivities | Hamster, Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 206 of rat SCD |
Rabbit Polyclonal ACSL1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal ACSL1 antibody was raised against an 18 amino acid peptide near the center of human ACSL1. The immunogen is located within amino acids 240 - 290 of ACSL1. |
Rabbit Polyclonal Anti-ACSL1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the C terminal of human ACSL1. Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG |
Rabbit Polyclonal Anti-CPT1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CPT1A Antibody: synthetic peptide directed towards the middle region of human CPT1A. Synthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN |