Goat Anti-GATA3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1. |
Goat Anti-GATA3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1. |
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
Conjugation | Unconjugated |
Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926) |
Goat Anti-Calnexin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SKTPELNLDQFHDKT, from the internal region (near N-Terminus) of the protein sequence according to NP_001737.1. |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Goat Polyclonal Antibody against HCRTR1
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YNFLSGKFREQFK, from the internal region of the protein sequence according to NP_001516.1; NP_001517.1. |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Goat Polyclonal Anti-Vimentin Antibody
Applications | FC, IF, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Goat Polyclonal Anti-Aconitase 2 (aa541-555) Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Aconitase 2 (aa541-555) Antibody: Peptide with sequence C-QDTYQHPPKDSSGQH, from the internal region of the protein sequence according to NP_001089.1. |
Goat Polyclonal Antibody against DKK1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237) |
Goat Polyclonal Antibody against HPS6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence LRTELRDYRGLEC, from the internal region of the protein sequence according to NP_079023. |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 362 and 426 of Inhibin beta A |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal GC Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC. |
Rabbit Polyclonal Anti-OAT Antibody
Applications | IHC, WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OAT antibody: synthetic peptide directed towards the C terminal of human OAT. Synthetic peptide located within the following region: VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI |
Goat Polyclonal Anti-NDUFA7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
Conjugation | Unconjugated |
Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Goat Polyclonal Anti-PCNA Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PCNA Antibody: Peptide with sequence C-NGNIKLSQTSNVD, from the internal region of the protein sequence according to NP_002583.1. |
Goat Polyclonal Anti-IDH3B (aa33-46) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IDH3B (aa33-46) Antibody: Peptide with sequence C-HAASRSQAEDVRVE, from the internal region (near N Terminus) of the protein sequence according to NP_008830.2; NP_777280.1. |
Goat Polyclonal Anti-IDH3A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IDH3A Antibody: Peptide with sequence DFTEEICRRVKDLD, from the C Terminus of the protein sequence according to NP_005521.1. |
Goat Polyclonal Anti-CDH1 (aa662-675) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CDH1 (aa662-675) Antibody: Peptide with sequence C-DYKINLKLMDNQNK, from the internal region of the protein sequence according to NP_004351.1. |
Goat Polyclonal Antibody against PRPF31
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KELGNSLDKCKNNEN, from the internal region of the protein sequence according to NP_056444.2. |
Goat Polyclonal Antibody against BAK1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence ASGQGPGPPRQE-C, from the N Terminus of the protein sequence according to NP_001179. |
Goat Anti-CAV3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EHTDLEAQIVKDIH-C, from the N Terminus of the protein sequence according to NP_203123.1. |
Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093) |
Rabbit Polyclonal antibody to SSA1 (tripartite motif-containing 21)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 254 and 475 of SSA1 (Uniprot ID#P19474) |
Goat Polyclonal Antibody against FOXP3 / SCURFIN
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SQRPSRCSNPTPGP, from the C Terminus of the protein sequence according to NP_054728.2. |
Goat Polyclonal Antibody against MTR
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245. |
Goat Polyclonal Antibody against KLF3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence LMFDPVPVKQEAMD-C, from the N Terminus of the protein sequence according to NP_057615. |
Goat Anti-ERN1 / IRE1a Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PNAHGKIKAMISD, from the internal region of the protein sequence according to NP_001424.3. |
Rabbit polyclonal antibody to RAG2 (recombination activating gene 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 271 and 527 of RAG2 (Uniprot ID#P55895) |
Rabbit Polyclonal antibody to VCP (valosin-containing protein)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of VCP (Uniprot ID#P55072) |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 23 and 218 of HPRT (Uniprot ID#P00492) |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
Rabbit polyclonal SMAD3-S208 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-DEFB129 Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DEFB129 antibody is: synthetic peptide directed towards the C-terminal region of Human DEFB129. Synthetic peptide located within the following region: TSFFANTNFVIIPNATPMNSATISTMTPGQITYTATSTKSNTKESRDSAT |
Goat Polyclonal Anti-PRDM1 / MEL1 Antibody
Applications | IHC, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PRDM1 / MEL1 Antibody: Peptide with sequence C-DISDNADRLEDVED, from the internal region of the protein sequence according to NP_001189.2; NP_878911.1. |
Goat Polyclonal Antibody against DLC1 (Isoforms 1 and 3)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SVAIRKRSWEEHC, from the N Terminus of the protein sequence according to NP_872584.1; NP_079043.2. |
Goat Polyclonal Antibody against PNPLA3
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EHDICPKVKSTN, from the internal region of the protein sequence according to NP_473429.2. |
Goat Anti-KLF1 / EKLF Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence ATAETALPSISTLT-C, from the N Terminus of the protein sequence according to NP_006554.1. |
Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 223 and 502 of O-GlcNAc transferase (Uniprot ID#O15294) |
Rabbit Polyclonal antibody to SOCS5 (suppressor of cytokine signaling 5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 1 and 42 of SOCS5 |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 218 of HPRT (Uniprot ID#P00492) |
Rabbit polyclonal antibody to PGAM2 (phosphoglycerate mutase 2 (muscle))
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 253 of PGAM2 (Uniprot ID#P15259) |