Products

cDNA Clones (36)
Proteins (15)
RNAi (12)
Gene Expression (8)
Antibodies (3)
Jump to Filters
View as table Download
BPNT1 (NM_006085) Human Tagged ORF Clone
RC216622

USD 420.00

In Stock

BPNT1 (Myc-DDK-tagged)-Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
BPNT1 (NM_006085) Human Tagged ORF Clone Lentiviral Particle
RC216622L1V

USD 820.00

3 Weeks

Lenti ORF particles, BPNT1 (Myc-DDK tagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
BPNT1 (NM_006085) Human Tagged ORF Clone Lentiviral Particle
RC216622L2V

USD 820.00

6 Weeks

Lenti ORF particles, BPNT1 (mGFP-tagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Bpnt1 (NM_011794) Mouse Tagged ORF Clone
MR204360

USD 68.00

USD 219.00

In Stock

Bpnt1 (Myc-DDK-tagged) - Mouse bisphosphate 3'-nucleotidase 1 (Bpnt1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BPNT1 (NM_006085) Human Tagged ORF Clone
RG216622

USD 460.00

In Stock

BPNT1 (GFP-tagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BPNT1 Human Gene Knockout Kit (CRISPR)
KN416622

USD 1,290.00

2 Weeks

BPNT1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN416622 is the updated version of KN216622.
Bpnt1 Mouse Gene Knockout Kit (CRISPR)
KN502244

USD 1,290.00

2 Weeks

Bpnt1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN502244 is the updated version of KN302244.
Bpnt1 (BC011036) Mouse Tagged ORF Clone
MG204360

USD 300.00

3 Weeks

Bpnt1 (GFP-tagged) - Mouse bisphosphate 3'-nucleotidase 1 (cDNA clone MGC:13732 IMAGE:4160742)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Bpnt1 (NM_011794) Mouse Tagged ORF Clone
MR204360L3

USD 500.00

3 Weeks

Lenti ORF clone of Bpnt1 (Myc-DDK-tagged) - Mouse bisphosphate 3'-nucleotidase 1 (Bpnt1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bpnt1 (NM_011794) Mouse Tagged ORF Clone Lentiviral Particle
MR204360L3V

USD 700.00

6 Weeks

Lenti ORF particles, Bpnt1 (Myc-DDK-tagged) - Mouse bisphosphate 3'-nucleotidase 1 (Bpnt1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bpnt1 (NM_011794) Mouse Tagged ORF Clone
MR204360L4

USD 500.00

3 Weeks

Lenti ORF clone of Bpnt1 (mGFP-tagged) - Mouse bisphosphate 3'-nucleotidase 1 (Bpnt1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bpnt1 (NM_011794) Mouse Tagged ORF Clone Lentiviral Particle
MR204360L4V

USD 700.00

6 Weeks

Lenti ORF particles, Bpnt1 (GFP-tagged) - Mouse bisphosphate 3'-nucleotidase 1 (Bpnt1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BPNT1 (NM_006085) Human Tagged ORF Clone
RC216622L3

USD 620.00

3 Weeks

Lenti ORF clone of Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BPNT1 (NM_006085) Human Tagged ORF Clone Lentiviral Particle
RC216622L3V

USD 820.00

5 Weeks

Lenti ORF particles, BPNT1 (Myc-DDK tagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BPNT1 (NM_006085) Human Tagged ORF Clone
RC216622L4

USD 620.00

3 Weeks

Lenti ORF clone of Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BPNT1 (NM_006085) Human Tagged ORF Clone Lentiviral Particle
RC216622L4V

USD 820.00

7 Weeks

Lenti ORF particles, BPNT1 (mGFP-tagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BPNT1 (NM_001286149) Human Tagged ORF Clone
RC236955

USD 420.00

2 Weeks

BPNT1 (myc-DDK-tagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BPNT1 (NM_001286151) Human Tagged ORF Clone
RC236956

USD 420.00

2 Weeks

BPNT1 (myc-DDK-tagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BPNT1 (NM_001286150) Human Tagged ORF Clone
RC237076

USD 420.00

2 Weeks

BPNT1 (myc-DDK-tagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Bpnt1 (NM_171990) Rat Tagged ORF Clone
RR209568

USD 420.00

4 Weeks

Bpnt1 (Myc-DDK-tagged ORF) - Rat 3'(2'), 5'-bisphosphate nucleotidase 1 (Bpnt1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Bpnt1 (NM_171990) Rat Tagged ORF Clone
RR209568L3

USD 640.00

8 Weeks

Lenti ORF clone of Bpnt1 (Myc-DDK-tagged ORF) - Rat 3'(2'), 5'-bisphosphate nucleotidase 1 (Bpnt1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bpnt1 (NM_171990) Rat Tagged ORF Clone Lentiviral Particle
RR209568L3V

USD 850.00

12 Weeks

Lenti ORF particles, Bpnt1 (Myc-DDK-tagged ORF) - Rat 3'(2'), 5'-bisphosphate nucleotidase 1 (Bpnt1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bpnt1 (NM_171990) Rat Tagged ORF Clone
RR209568L4

USD 700.00

8 Weeks

Lenti ORF clone of Bpnt1 (mGFP-tagged ORF) - Rat 3'(2'), 5'-bisphosphate nucleotidase 1 (Bpnt1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bpnt1 (NM_171990) Rat Tagged ORF Clone Lentiviral Particle
RR209568L4V

USD 960.00

12 Weeks

Lenti ORF particles, Bpnt1 (GFP-tagged ORF) - Rat 3'(2'), 5'-bisphosphate nucleotidase 1 (Bpnt1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BPNT1 (NM_006085) Human Tagged ORF Clone
RC216622L1

USD 768.00

In Stock

Lenti ORF clone of Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BPNT1 Rabbit Polyclonal Antibody
TA344274

USD 475.00

5 Days

Rabbit Polyclonal Anti-BPNT1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BPNT1 antibody: synthetic peptide directed towards the N terminal of human BPNT1. Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP
BPNT1 (NM_006085) Human Tagged ORF Clone
RC216622L2

USD 620.00

3 Weeks

Lenti ORF clone of Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BPNT1 (NM_006085) Human Over-expression Lysate
LC416871

USD 121.00

In Stock

BPNT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Bpnt1 (NM_011794) Mouse Untagged Clone
MC200914

USD 210.00

In Stock

Bpnt1 (untagged) - Mouse bisphosphate 3'-nucleotidase 1 (Bpnt1), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
BPNT1 (NM_006085) Human Untagged Clone
SC116312

USD 660.00

In Stock

BPNT1 (untagged)-Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
BPNT1 (C-term) Rabbit Polyclonal Antibody
AP50387PU-N

USD 450.00

2 Weeks

BPNT1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 276-305 amino acids from the C-terminal region of human BPNT1
BPNT1 Goat Polyclonal Antibody
TA303272

USD 375.00

5 Days

Goat Polyclonal Antibody against BPNT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RNYDYYASRVPESIK, from the C Terminus of the protein sequence according to NP_006076.4.
BPNT1 (1-308, His-tag) Human Protein
AR09823PU-L

USD 845.00

2 Weeks

BPNT1 (1-308, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
BPNT1 (1-308, His-tag) Human Protein
AR09823PU-N

USD 330.00

2 Weeks

BPNT1 (1-308, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Human BPNT1 activation kit by CRISPRa
GA107070

USD 1,290.00

2 Weeks

BPNT1 CRISPRa kit - CRISPR gene activation of human 3'(2'), 5'-bisphosphate nucleotidase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Bpnt1 activation kit by CRISPRa
GA204768

USD 1,290.00

2 Weeks

Bpnt1 CRISPRa kit - CRISPR gene activation of mouse bisphosphate 3'-nucleotidase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
BPNT1 Human qPCR Template Standard (NM_006085)
HK209808

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene BPNT1

Application Plasmid of exact quantity for transcript copy number calculation
BPNT1 Human qPCR Primer Pair (NM_006085)
HP209095

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene BPNT1

BPNT1 (NM_006085) Human Over-expression Lysate
LY416871

USD 396.00

5 Days

Transient overexpression lysate of 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Bpnt1 Mouse qPCR Template Standard (NM_011794)
MK200603

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Bpnt1

Application Plasmid of exact quantity for transcript copy number calculation
Bpnt1 Mouse qPCR Primer Pair (NM_011794)
MP201342

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Bpnt1

BPNT1 (NM_006085) Human Mass Spec Standard
PH316622

USD 2,055.00

3 Weeks

BPNT1 MS Standard C13 and N15-labeled recombinant protein (NP_006076)

Tag C-Myc/DDK
Expression Host HEK293
BPNT1 (NM_001286149) Human Tagged ORF Clone
RG236955

USD 460.00

2 Weeks

BPNT1 (GFP-tagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BPNT1 (NM_001286151) Human Tagged ORF Clone
RG236956

USD 460.00

2 Weeks

BPNT1 (GFP-tagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BPNT1 (NM_001286150) Human Tagged ORF Clone
RG237076

USD 460.00

2 Weeks

BPNT1 (GFP-tagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Bpnt1 (NM_171990) Rat Untagged Clone
RN209568

USD 420.00

4 Weeks

Bpnt1 (untagged ORF) - Rat 3'(2'), 5'-bisphosphate nucleotidase 1 (Bpnt1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
BPNT1 (BC017801) Human Untagged Clone
SC123598

USD 310.00

3 Weeks

BPNT1 (untagged)-Human 3'(2'), 5'-bisphosphate nucleotidase 1 (cDNA clone MGC:22359 IMAGE:4338207), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
BPNT1 (NM_006085) Human 3' UTR Clone
SC214152

USD 560.00

4 Weeks

3`UTR clone of 3'(2') 5'-bisphosphate nucleotidase 1 (BPNT1) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
BPNT1 (NM_006085) Human Untagged Clone
SC317461

USD 660.00

3 Weeks

BPNT1 (untagged)-Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
BPNT1 (NM_001286149) Human Untagged Clone
SC334849

USD 477.00

2 Weeks

BPNT1 (untagged) - Human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin