Primary Antibodies

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

Rabbit Polyclonal RNAse H2A Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RNAse H2A antibody was raised against a 17 amino acid peptide near the center of human RNAse H2A.

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABCC4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4

Rabbit Polyclonal Anti-NOX4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4.

Rabbit Polyclonal PD-L1 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1.

Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L).
Modifications Phospho-specific

Rabbit Polyclonal VLK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK.

DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3

Rabbit anti-Nono Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A specific peptide of human Nono

Rabbit Polyclonal Dact2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Dact2 antibody was raised against a 12 amino acid peptide from near the amino terminus of human DACT2.

DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3

Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3

Rabbit Polyclonal Anti-BDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).

Rabbit Polyclonal Anti-NGF Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NGF

Rabbit anti-REG3A Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human REG3A

Rabbit Polyclonal OCLN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN.

Rabbit anti-IRF3 Polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IRF3

Calca rabbit polyclonal antibody

Applications IF, IHC
Reactivities Human, Mammalian, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde.

Rabbit Polyclonal Anti-Amyloid Oligomers (A11) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Eukaryotes
Conjugation Unconjugated
Immunogen Synthetic molecular mimic of soluble oligomers.

Rabbit polyclonal Anti-Na+/H+ Exchanger 1 (NHE-1) (extracellular)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RERSIGDVTTAPSE, corresponding to amino acid residues 54-67 of rat NHE-1 . 1st extracellular loop.

Rabbit anti-ZEB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ZEB1

Rabbit Polyclonal Anti-TET1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1.

Rabbit Polyclonal IRAK-M Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M.

Rabbit anti-ADH5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADH5

Rabbit anti-HDGF Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HDGF

YB-1/YBX1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2).
Modifications Unmodified

YB-1/YBX1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2).
Modifications Unmodified

Rabbit Polyclonal Antibody against LC3

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 50-150).

Rabbit Polyclonal Nephrin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin.

MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3

TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Rabbit Polyclonal RHBDD2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RHBDD2 antibody was raised against an 18 amino acid peptide from near the center of human RHBDD2.

Rabbit Polyclonal Ogg1 Antibody

Applications IHC, WB
Reactivities Human, Primate, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the human Ogg1 (within amino acids 1-100).

Rabbit Polyclonal FOXP3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3.

PPP4C Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP4C

Ku70 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1).
Modifications Unmodified

Ku70 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1).
Modifications Unmodified

Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal STIM1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1.

Rabbit polyclonal anti-p15 INK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human p15 INK antibody.

PRMT5 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human PRMT5

Rabbit Polyclonal Anti-TRPP1 (PKD2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)ERWESDDAASQISH, corresponding to amino acid residues 914-927 of human TRPP1. Intracellular, C-terminus.

Rabbit anti-S100A12 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human S100A12

Rabbit Polyclonal Aggrecan Neoepitope Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112]

Rabbit Polyclonal Anti-SMURF2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2.