Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
EPCAM mouse monoclonal antibody, clone 323/A3, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
USD 430.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 240.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
USD 380.00
2 Weeks
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Feline, Human, Rabbit |
USD 480.00
2 Weeks
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
PBR (TSPO) (C-term) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide C-RDNSGRRGGSRLPE from the C-terminus of Mouse TSPO (NP_033905.3). Percent identity with other species by BLAST analysis: Mouse (100%), Rat (93%). C-Terminus |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Active filters
Applications
- IHC
Families
- Transmembrane
Citations
- Yes
Filter by
Category
Target Symbol
- BAX (7)
- LGR5 (7)
- CD19 (5)
- CD4 (5)
- CDH2 (5)
- PECAM1 (5)
- CA9 (4)
- CD163 (4)
- CD274 (4)
- CD8A (4)
- CDH1 (4)
- CLEC4E (4)
- EPCAM (4)
- ERBB2 (4)
- MME (4)
- SLC7A8 (4)
- BCL2 (3)
- CD3E (3)
- CD44 (3)
- CD68 (3)
- CDH3 (3)
- CTLA4 (3)
- MS4A1 (3)
- MSR1 (3)
- NCAM1 (3)
- PDCD1 (3)
- PTCH1 (3)
- SLC18A2 (3)
- TMEM100 (3)
- ABCC4 (2)
- ABCG2 (2)
- APMAP (2)
- AQP1 (2)
- B3GNT2 (2)
- BCL2L1 (2)
- BDNF (2)
- BTN3A2 (2)
- CCR6 (2)
- CD1C (2)
- CD34 (2)
- CD40 (2)
- CD7 (2)
- CD74 (2)
- CD81 (2)
- CD99 (2)
- CDH5 (2)
- CR2 (2)
- CYP2A6 (2)
- CYP2E1 (2)
- DPP4 (2)
- DPP8 (2)
- DRD2 (2)
- EGFR (2)
- FBXW7 (2)
- FGFR2 (2)
- FGFR3 (2)
- ICAM1 (2)
- L1CAM (2)
- MET (2)
- MICOS10 (2)
- NEU1 (2)
- NPR3 (2)
- NTRK1 (2)
- NTRK2 (2)
- PRNP (2)
- PTPRE (2)
- ROMO1 (2)
- ROR2 (2)
- RXFP1 (2)
- SDCBP (2)
- SIL1 (2)
- SYP (2)
- TGFBR2 (2)
- TRPM4 (2)
- UBE2J1 (2)
- WFDC2 (2)
- ABCC5 (1)
- ACSL3 (1)
- ACSL4 (1)
- ADAM10 (1)
- ADCY1 (1)
- ANPEP (1)
- ANTXR1 (1)
- AQP4 (1)
- B3GLCT (1)
- BCL2L10 (1)
- BCL2L2 (1)
- BST2 (1)
- CALCRL (1)
- CALN1 (1)
- CANX (1)
- CAV1 (1)
- CD276 (1)
- CD46 (1)
- CD5 (1)
- CD63 (1)
- CD80 (1)
- CDCP1 (1)
- CDH8 (1)
- CHRM1 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Cell adhesion molecules (CAMs) (61)
- Hematopoietic cell lineage (45)
- Pathways in cancer (42)
- Cytokine-cytokine receptor interaction (21)
- Colorectal cancer (20)
- Focal adhesion (20)
- Primary immunodeficiency (20)
- T cell receptor signaling pathway (20)
- MAPK signaling pathway (18)
- Metabolic pathways (18)
- Adherens junction (17)
- Apoptosis (16)
- Endocytosis (16)
- Neurotrophin signaling pathway (16)
- Neuroactive ligand-receptor interaction (15)
- Antigen processing and presentation (14)
- Calcium signaling pathway (14)
- Prostate cancer (14)
- Regulation of actin cytoskeleton (14)
- Amyotrophic lateral sclerosis (ALS) (13)
- Bladder cancer (12)
- Leukocyte transendothelial migration (12)
- Prion diseases (12)
- Huntington's disease (11)
- Melanoma (11)
- ECM-receptor interaction (10)
- Endometrial cancer (10)
- Pancreatic cancer (10)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (9)
- B cell receptor signaling pathway (9)
- Autoimmune thyroid disease (8)
- Gap junction (8)
- Lysosome (8)
- Viral myocarditis (8)
- Alzheimer's disease (7)
- Parkinson's disease (7)
- Small cell lung cancer (7)
- Systemic lupus erythematosus (7)
- Toll-like receptor signaling pathway (7)
- p53 signaling pathway (7)
- Adipocytokine signaling pathway (6)
- Allograft rejection (6)
- Dilated cardiomyopathy (6)
- ErbB signaling pathway (6)
- Natural killer cell mediated cytotoxicity (6)
- Non-small cell lung cancer (6)
- Thyroid cancer (6)
- ABC transporters (5)
- Axon guidance (5)
- Drug metabolism - cytochrome P450 (5)
- Epithelial cell signaling in Helicobacter pylori infection (5)
- Glioma (5)
- Hypertrophic cardiomyopathy (HCM) (5)
- Pathogenic Escherichia coli infection (5)
- Renin-angiotensin system (5)
- Asthma (4)
- Basal cell carcinoma (4)
- Chemokine signaling pathway (4)
- Chronic myeloid leukemia (4)
- Complement and coagulation cascades (4)
- Graft-versus-host disease (4)
- Jak-STAT signaling pathway (4)
- Metabolism of xenobiotics by cytochrome P450 (4)
- Nitrogen metabolism (4)
- PPAR signaling pathway (4)
- Retinol metabolism (4)
- Type I diabetes mellitus (4)
- Ubiquitin mediated proteolysis (4)
- Dorso-ventral axis formation (3)
- Drug metabolism - other enzymes (3)
- Fc gamma R-mediated phagocytosis (3)
- GnRH signaling pathway (3)
- Hedgehog signaling pathway (3)
- Linoleic acid metabolism (3)
- Renal cell carcinoma (3)
- TGF-beta signaling pathway (3)
- Arachidonic acid metabolism (2)
- Caffeine metabolism (2)
- Fatty acid metabolism (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Keratan sulfate biosynthesis (2)
- Melanogenesis (2)
- Notch signaling pathway (2)
- Oocyte meiosis (2)
- Other glycan degradation (2)
- Primary bile acid biosynthesis (2)
- Progesterone-mediated oocyte maturation (2)
- RIG-I-like receptor signaling pathway (2)
- Sphingolipid metabolism (2)
- Vascular smooth muscle contraction (2)
- Biosynthesis of unsaturated fatty acids (1)
- Cardiac muscle contraction (1)
- Chondroitin sulfate biosynthesis (1)
- Cytosolic DNA-sensing pathway (1)
- Fc epsilon RI signaling pathway (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycolysis / Gluconeogenesis (1)
- Insulin signaling pathway (1)
- Long-term depression (1)
- Long-term potentiation (1)
- N-Glycan biosynthesis (1)
- NOD-like receptor signaling pathway (1)
- O-Glycan biosynthesis (1)
- Oxidative phosphorylation (1)
- Porphyrin and chlorophyll metabolism (1)
- Purine metabolism (1)
- Starch and sucrose metabolism (1)
- Tight junction (1)
- Tryptophan metabolism (1)
- Type II diabetes mellitus (1)
- Tyrosine metabolism (1)
- VEGF signaling pathway (1)
- Wnt signaling pathway (1)