Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Supernatant
| Applications | IHC |
| Reactivities | Human |
USD 405.00
2 Weeks
beta Actin (ACTB) (Loading Control) mouse monoclonal antibody, clone G043, Aff - Purified
| Applications | IF, WB |
| Reactivities | All Species |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e) |
Rabbit Polyclonal Anti-CDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDH2 Antibody: A synthesized peptide derived from human CDH2 |
Chicken Polyclonal Anti-Beta-actin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Beta-actin antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human beta-actin. |
Rabbit Polyclonal Anti-ACTIN Antibody
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of Arabidopsis thaliana actin |
USD 379.00
In Stock
beta Actin (ACTB) mouse monoclonal antibody, clone AC-15, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
alpha Actinin (ACTN1) mouse monoclonal antibody, clone SA-20, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
beta Actin (ACTB) (Loading Control) mouse monoclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | All Species |
beta Actin (ACTB) mouse monoclonal antibody, clone 26F7, Aff - Purified
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Rabbit Monoclonal Antibody against ACTN1 (Clone EP2527Y)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to Integrin alpha 6 (integrin, alpha 6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 565 and 872 of Integrin alpha 6 (Uniprot ID#P23229) |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Active filters
Families
- ES Cell Differentiation/IPS
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Filter by
Category
Target Symbol
Reactivities
- Human (331)
- Mouse (281)
- Rat (265)
- Monkey (99)
- Dog (83)
- Chicken (7)
- Rabbit (5)
- Bovine (4)
- Canine (4)
- Drosophila (4)
- Hamster (3)
- Zebrafish (3)
- Cow (2)
- Pig (2)
- Primate (2)
- Rhesus Monkey (2)
- All Species (1)
- Avian (1)
- Baboon (1)
- Bat (1)
- Broad (1)
- Chimpanzee (1)
- Goat (1)
- Guinea Pig (1)
- Horse (1)
- Porcine (1)
- Sheep (1)
- Xenopus (1)