Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GFAP Capture mouse monoclonal antibody, Luminex validated, clone OTI4D11
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700041 |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Anti-GAPDH mouse mAb (Loading control)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Rat
Families
- ES Cell Differentiation/IPS
Filter by
Target Symbol
- JUN (176)
- ABCB1 (163)
- GLI1 (148)
- CTNNB1 (144)
- EGFR (139)
- VIM (122)
- AKT1 (109)
- L1CAM (92)
- NKX2-1 (86)
- BCL2 (72)
- GFAP (71)
- STAT5A (71)
- NCAM1 (65)
- PIK3CG (60)
- PDGFRA (55)
- TNNI3 (55)
- NEUROG1 (52)
- SMAD1 (47)
- HES1 (46)
- LHX1 (46)
- TAL1 (46)
- GATA3 (45)
- ID3 (45)
- CDX2 (42)
- GAPDH (42)
- CDH2 (39)
- AKT2 (38)
- MAPK8 (37)
- PDX1 (37)
- PDGFRB (36)
- CASP3 (35)
- DVL2 (35)
- HNF4A (33)
- PTCH1 (31)
- HGF (28)
- IRF6 (28)
- KDR (27)
- MAPK9 (27)
- SMAD2 (26)
- ACTB (25)
- BMP6 (23)
- MPI (23)
- BCL2L1 (22)
- KLF5 (22)
- PRKCA (21)
- DLX1 (20)
- IGF1 (20)
- NOTCH1 (20)
- SOX9 (20)
- YBX1 (20)
- ANGPT1 (19)
- CD4 (19)
- FN1 (19)
- GATA4 (18)
- NEFL (18)
- SMAD3 (18)
- SRC (18)
- AKT3 (16)
- ITGB3 (16)
- PTF1A (16)
- SMURF2 (16)
- TGFB1 (16)
- EVX1 (15)
- ITGB1 (15)
- MAPK3 (15)
- MAPK6 (15)
- SOX2 (15)
- BSG (14)
- ID2 (13)
- ID4 (13)
- JAG1 (13)
- SHH (13)
- FOXA1 (12)
- STAT5B (12)
- PAX7 (11)
- TAZ (11)
- TRIM33 (11)
- ACTN1 (10)
- FOXA2 (10)
- ISL1 (10)
- RUNX1 (10)
- MAP2 (9)
- NT5E (9)
- CDH1 (8)
- CEBPA (8)
- GATA1 (8)
- GCG (8)
- HNF1B (8)
- LEF1 (8)
- SP1 (8)
- TUBB3 (8)
- CD9 (7)
- GATA6 (7)
- PAX3 (7)
- BDNF (6)
- CD44 (6)
- ENPEP (6)
- HAND1 (6)
- HCRTR1 (6)
- HNF1A (6)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (1545)
- Focal adhesion (1141)
- Colorectal cancer (1073)
- ErbB signaling pathway (743)
- MAPK signaling pathway (740)
- Prostate cancer (722)
- Neurotrophin signaling pathway (556)
- Endometrial cancer (548)
- Melanoma (538)
- Wnt signaling pathway (528)
- Pancreatic cancer (526)
- Glioma (512)
- Toll-like receptor signaling pathway (478)
- T cell receptor signaling pathway (465)
- Renal cell carcinoma (463)
- GnRH signaling pathway (433)
- Epithelial cell signaling in Helicobacter pylori infection (432)
- Adherens junction (420)
- Regulation of actin cytoskeleton (420)
- B cell receptor signaling pathway (415)
- Basal cell carcinoma (403)
- Non-small cell lung cancer (401)
- Chronic myeloid leukemia (387)
- Tight junction (385)
- Acute myeloid leukemia (360)
- Small cell lung cancer (357)
- Apoptosis (354)
- Cytokine-cytokine receptor interaction (353)
- Jak-STAT signaling pathway (352)
- Progesterone-mediated oocyte maturation (326)
- Fc epsilon RI signaling pathway (323)
- Insulin signaling pathway (307)
- VEGF signaling pathway (304)
- Leukocyte transendothelial migration (301)
- Gap junction (297)
- Cell adhesion molecules (CAMs) (288)
- Endocytosis (279)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (265)
- Fc gamma R-mediated phagocytosis (264)
- Chemokine signaling pathway (262)
- mTOR signaling pathway (262)
- TGF-beta signaling pathway (256)
- Calcium signaling pathway (252)
- Melanogenesis (241)
- Hedgehog signaling pathway (235)
- Adipocytokine signaling pathway (233)
- Pathogenic Escherichia coli infection (221)
- Type II diabetes mellitus (180)
- Thyroid cancer (176)
- Dorso-ventral axis formation (174)
- ABC transporters (166)
- Bladder cancer (165)
- Hypertrophic cardiomyopathy (HCM) (158)
- Maturity onset diabetes of the young (155)
- Dilated cardiomyopathy (154)
- Amyotrophic lateral sclerosis (ALS) (147)
- Natural killer cell mediated cytotoxicity (139)
- Axon guidance (131)
- Notch signaling pathway (125)
- Prion diseases (102)
- Alzheimer's disease (96)
- Metabolic pathways (96)
- Hematopoietic cell lineage (83)
- Phosphatidylinositol signaling system (81)
- NOD-like receptor signaling pathway (79)
- Viral myocarditis (79)
- ECM-receptor interaction (70)
- RIG-I-like receptor signaling pathway (67)
- Cell cycle (60)
- Inositol phosphate metabolism (60)
- p53 signaling pathway (57)
- Long-term depression (56)
- Cardiac muscle contraction (55)
- Huntington's disease (49)
- Vibrio cholerae infection (46)
- Glycolysis / Gluconeogenesis (43)
- Oocyte meiosis (39)
- Long-term potentiation (36)
- Vascular smooth muscle contraction (36)
- Antigen processing and presentation (35)
- Parkinson's disease (35)
- Primary immunodeficiency (24)
- Amino sugar and nucleotide sugar metabolism (23)
- Fructose and mannose metabolism (23)
- Type I diabetes mellitus (22)
- Autoimmune thyroid disease (20)
- Allograft rejection (19)
- Graft-versus-host disease (18)
- Ubiquitin mediated proteolysis (16)
- Renin-angiotensin system (13)
- Systemic lupus erythematosus (12)
- Neuroactive ligand-receptor interaction (11)
- Nicotinate and nicotinamide metabolism (10)
- Purine metabolism (9)
- Pyrimidine metabolism (9)
- Retinol metabolism (8)
- Tyrosine metabolism (7)
- Complement and coagulation cascades (6)
- Cysteine and methionine metabolism (6)
- Phenylalanine (6)
- Phenylalanine metabolism (6)
- Ubiquinone and other terpenoid-quinone biosynthesis (6)
- tyrosine and tryptophan biosynthesis (6)
- Lysosome (4)
- Regulation of autophagy (4)
- Drug metabolism - cytochrome P450 (3)
- Drug metabolism - other enzymes (3)
- Glutathione metabolism (3)
- Linoleic acid metabolism (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- Oxidative phosphorylation (3)
- Starch and sucrose metabolism (2)
- Asthma (1)
- Citrate cycle (TCA cycle) (1)
- PPAR signaling pathway (1)
- Pyruvate metabolism (1)