Germany
Japan
United Kingdom
China
Antibodies
Symetric Dimethylarginine (SDMA) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, R, WB |
| Immunogen | Symmetric Dimethylarginine (SDMA) KLH-conjugated. |
VIP rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Porcine VIP coupled to bovine thyroglobulin (BTg) with carbodiimide (CDI) linker. |
Candida albicans rabbit polyclonal antibody, Purified
| Applications | ELISA, ID, Ie, IF, IHC |
| Reactivities | Candida |
| Immunogen | Candida albicans, type A (ATTCC #32354). |
S1PR2 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 281-330 of Human EDG-5. |
Lyve1 rabbit polyclonal antibody, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Immunogen | Highly pure recombinant Mouse soluble LYVE-1 (Ala24-Gly228) produced in insect cells (Cat.-No DA3524). This recombinant soluble LYVE-1 consists of amino acid 24 (Ala) to 228 (Gly) and is fused to a C-terminal His-tag (6xHis). |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
PGK1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
LYVE1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure recombinant Human soluble LYVE-1 produced in insect cells (Cat.-No DA3525). It consists of amino acid 24 (Ser) to 232 (Gly) and is fused to a C-terminal His-tag (6xHis). |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Serotonin rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian, Snail |
Borrelia burgdorferi rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Bacteria |
| Immunogen | Whole cell preparation from B. burgdorferi (Strain: B31 ATCC#35210) |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
GFP (Ads. to Hu, Ms, Rt Serum Proteins) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | A. victoria |
| Immunogen | Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria |
S1PR2 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 271-320 of Human EDG-5. |
Sodium Iodide Symporter (SLC5A5) (C-term) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Porcine, Rat |
| Immunogen | Synthetic peptide from the C-terminus of Rat NIS |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
TGF beta Receptor I (TGFBR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 150-200 of Human TGFβ RI. |
Thermolysin rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bacillus sp. |
| Immunogen | Thermolysin isolated and purified from Bacillus thermoproteolyticus rokko. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Procollagen Type III rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bovine, Human, Porcine |
| Immunogen | Purified Human Procollagen type III C-terminal and N-terminal PIIICP separated. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-HNRPA0 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Active filters
Applications
- IF
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Filter by
Target Symbol
- H3C1 (30)
- COL1A1 (20)
- HISTONE H3 (18)
- AKT1 (17)
- RPS6KB1 (16)
- HIST2H3A (15)
- ALB (14)
- IRS1 (14)
- MAPT (13)
- SNCA (13)
- STAT3 (13)
- SQSTM1 (12)
- BAX (11)
- RELA (11)
- CASP9 (10)
- FOXO1 (10)
- GAPDH (10)
- MAP1LC3B (10)
- MAPK8 (10)
- RB1 (10)
- TH (10)
- TP53 (10)
- BCL2 (9)
- CCNB1 (9)
- FOXO4 (9)
- MDH1 (9)
- PTK2 (9)
- RPS6 (9)
- CTNNB1 (8)
- ENO2 (8)
- GAP43 (8)
- HSPD1 (8)
- IRF3 (8)
- KDR (8)
- NTRK1 (8)
- RPS6KA1 (8)
- SMAD2 (8)
- STMN1 (8)
- TARDBP (8)
- AKT2 (7)
- APP (7)
- ATG7 (7)
- BRCA1 (7)
- CASP3 (7)
- COL4A1 (7)
- EGFR (7)
- GJA1 (7)
- HIST1H3A (7)
- HISTONE H4 (7)
- HSPA5 (7)
- IKBKG (7)
- JUN (7)
- KDM1A (7)
- MTOR (7)
- MYC (7)
- NFKBIA (7)
- NOS3 (7)
- PAK1 (7)
- PDGFRB (7)
- PKM (7)
- SYN1 (7)
- SYT1 (7)
- ATG5 (6)
- CA1 (6)
- CASP8 (6)
- CBX5 (6)
- CDKN2A (6)
- CFLAR (6)
- COL1A2 (6)
- COL2A1 (6)
- COL5A1 (6)
- CREB1 (6)
- FASN (6)
- GRIN2B (6)
- GSK3B (6)
- HDAC1 (6)
- HDAC5 (6)
- HDAC6 (6)
- HSP90AB1 (6)
- IKBKB (6)
- KLF4 (6)
- LAMP1 (6)
- LDHA (6)
- LDHB (6)
- LYZ (6)
- MAPK14 (6)
- MEF2A (6)
- MET (6)
- MKI67 (6)
- NBN (6)
- NPM1 (6)
- PECAM1 (6)
- PXN (6)
- PYCARD (6)
- RXFP1 (6)
- SCARB1 (6)
- TFAM (6)
- TGFB1 (6)
- TLR3 (6)
- VIM (6)
Reactivities
- Human (7135)
- Mouse (5679)
- Rat (4646)
- Bovine (354)
- Chicken (134)
- Pig (125)
- Rhesus Monkey (101)
- Monkey (94)
- Xenopus (92)
- Zebrafish (70)
- X. tropicalis (58)
- Dog (47)
- Chimpanzee (43)
- Hamster (43)
- Primate (41)
- Rabbit (39)
- Porcine (27)
- Sheep (24)
- Mammalian (20)
- Feline (16)
- C. elegans (13)
- Cow (13)
- Guinea Pig (13)
- Canine (11)
- Drosophila (11)
- SARS-CoV-2 (7)
- Avian (5)
- Broad (5)
- Goat (5)
- Fish (3)
- Coral (2)
- Equine (2)
- Fusion proteins containing the Flag Tag (2)
- Beluga (1)
- Birds (1)
- Carp (1)
- Dogfish (1)
- Frog (1)
- Fungus (1)
- Hagfish (1)
- Horse (1)
- Invertebrate (1)
- Medaka fish (1)
- Mink (1)
- Mustelid (1)
- Orang-Utan (1)
- Quail (1)
- SARS-CoV (1)
- SimianIVE (1)
- Staphylococcus aureus (1)
- Streptococcus Pyogenes (1)
- Tobacco (1)
- Tomato (1)
- Yeast (1)
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (2518)
- Phospho-specific (141)
- Acetyl K5 (3)
- Acetyl K12 (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K16 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K29 (1)
- Acetyl K36 (1)
- Acetyl K4 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S2056 (1)
- Phospho S241 (1)
- Phospho S2448 (1)
- Phospho S28 (1)
- Phospho S428 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S519/T522 (1)
- Phospho S70 (1)
- Phospho S9 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T180/Y182 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T389 (1)
- Phospho T395 (1)
- Phospho T45 (1)
- Phospho T498 (1)
- Phospho T6 (1)
- Phospho T91 (1)
- Phospho Y1022/1023 (1)
- Phospho Y15 (1)
- Phospho Y705 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
Assay Types
Families
- Druggable Genome (2884)
- Transmembrane (1307)
- Transcription Factors (690)
- Protein Kinase (409)
- Secreted Protein (337)
- ES Cell Differentiation/IPS (280)
- GPCR (234)
- Stem cell - Pluripotency (233)
- Protease (121)
- Embryonic stem cells (61)
- Adult stem cells (51)
- Induced pluripotent stem cells (44)
- Nuclear Hormone Receptor (41)
- Phosphatase (34)
- Cancer stem cells (29)
- Stem cell relevant signaling - JAK/STAT signaling pathway (29)
- Ion Channels: Other (25)
- P450 (24)
- Ion Channels: Glutamate Receptors (21)
- Ion Channels: Transient receptor potential (17)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (16)
- Stem cell relevant signaling - DSL/Notch pathway (13)
- Ion Channels: Potassium (12)
- Stem cell relevant signaling - Wnt Signaling pathway (11)
- Ion Channels: ATP Receptors (4)
- Ion Channels: Cys-loop Receptors (4)
- Ion Channels: Cyclic nucleotide gated (3)
- Ion Channels: Calcium (2)
Pathways
- Pathways in cancer (406)
- Metabolic pathways (313)
- Focal adhesion (217)
- MAPK signaling pathway (211)
- Neuroactive ligand-receptor interaction (196)
- Neurotrophin signaling pathway (178)
- Cytokine-cytokine receptor interaction (160)
- Prostate cancer (160)
- Chemokine signaling pathway (153)
- Insulin signaling pathway (153)
- Small cell lung cancer (146)
- Colorectal cancer (145)
- Apoptosis (144)
- Regulation of actin cytoskeleton (137)
- Cell cycle (135)
- Toll-like receptor signaling pathway (134)
- Chronic myeloid leukemia (131)
- ErbB signaling pathway (128)
- Alzheimer's disease (122)
- Pancreatic cancer (118)
- Adipocytokine signaling pathway (117)
- T cell receptor signaling pathway (117)
- Calcium signaling pathway (109)
- Wnt signaling pathway (109)
- Olfactory transduction (106)
- Endocytosis (103)
- Huntington's disease (103)
- Acute myeloid leukemia (102)
- Progesterone-mediated oocyte maturation (101)
- Leukocyte transendothelial migration (97)
- Endometrial cancer (92)
- Jak-STAT signaling pathway (92)
- Melanoma (92)
- Glioma (91)
- NOD-like receptor signaling pathway (91)
- Non-small cell lung cancer (90)
- RIG-I-like receptor signaling pathway (90)
- Fc gamma R-mediated phagocytosis (89)
- p53 signaling pathway (89)
- Oocyte meiosis (87)
- VEGF signaling pathway (87)
- Systemic lupus erythematosus (86)
- mTOR signaling pathway (86)
- Axon guidance (82)
- B cell receptor signaling pathway (82)
- Amyotrophic lateral sclerosis (ALS) (81)
- Renal cell carcinoma (81)
- Natural killer cell mediated cytotoxicity (76)
- Parkinson's disease (75)
- Adherens junction (74)
- Epithelial cell signaling in Helicobacter pylori infection (72)
- Melanogenesis (70)
- Ubiquitin mediated proteolysis (68)
- Gap junction (67)
- Tight junction (67)
- ECM-receptor interaction (66)
- TGF-beta signaling pathway (64)
- Bladder cancer (61)
- Fc epsilon RI signaling pathway (61)
- Pathogenic Escherichia coli infection (60)
- Type II diabetes mellitus (57)
- GnRH signaling pathway (56)
- Cytosolic DNA-sensing pathway (54)
- Long-term potentiation (54)
- Vascular smooth muscle contraction (53)
- Glycolysis / Gluconeogenesis (48)
- Hematopoietic cell lineage (48)
- Antigen processing and presentation (45)
- Thyroid cancer (45)
- Basal cell carcinoma (44)
- Viral myocarditis (42)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (40)
- Purine metabolism (40)
- Cell adhesion molecules (CAMs) (39)
- Long-term depression (39)
- Regulation of autophagy (38)
- Notch signaling pathway (37)
- Hypertrophic cardiomyopathy (HCM) (36)
- Dilated cardiomyopathy (35)
- Spliceosome (32)
- Prion diseases (31)
- Complement and coagulation cascades (28)
- Lysosome (28)
- Oxidative phosphorylation (28)
- PPAR signaling pathway (28)
- Vibrio cholerae infection (28)
- Hedgehog signaling pathway (27)
- Primary immunodeficiency (27)
- Pyruvate metabolism (27)
- RNA degradation (27)
- Phosphatidylinositol signaling system (26)
- Arginine and proline metabolism (25)
- Metabolism of xenobiotics by cytochrome P450 (25)
- Citrate cycle (TCA cycle) (24)
- Base excision repair (23)
- Ribosome (23)
- Type I diabetes mellitus (20)
- Drug metabolism - cytochrome P450 (19)
- Inositol phosphate metabolism (19)
- Tyrosine metabolism (18)
- Arachidonic acid metabolism (17)
- Cardiac muscle contraction (17)
- Glutathione metabolism (17)
- Glycerolipid metabolism (17)
- Homologous recombination (17)
- Maturity onset diabetes of the young (17)
- Pyrimidine metabolism (17)
- Retinol metabolism (17)
- DNA replication (15)
- Non-homologous end-joining (15)
- Nucleotide excision repair (15)
- Glycerophospholipid metabolism (14)
- Mismatch repair (14)
- Propanoate metabolism (14)
- Valine (14)
- Cysteine and methionine metabolism (13)
- Dorso-ventral axis formation (13)
- Fatty acid metabolism (12)
- Butanoate metabolism (11)
- Taste transduction (11)
- Tryptophan metabolism (11)
- Alanine (10)
- Amino sugar and nucleotide sugar metabolism (10)
- Drug metabolism - other enzymes (10)
- Renin-angiotensin system (10)
- aspartate and glutamate metabolism (10)
- Glyoxylate and dicarboxylate metabolism (9)
- Graft-versus-host disease (9)
- Linoleic acid metabolism (9)
- Lysine degradation (9)
- Primary bile acid biosynthesis (9)
- leucine and isoleucine degradation (9)
- Allograft rejection (8)
- Fructose and mannose metabolism (8)
- Histidine metabolism (8)
- Nitrogen metabolism (8)
- Proteasome (8)
- beta-Alanine metabolism (8)
- Biosynthesis of unsaturated fatty acids (7)
- Glycine (7)
- O-Glycan biosynthesis (7)
- Pentose phosphate pathway (7)
- Porphyrin and chlorophyll metabolism (7)
- serine and threonine metabolism (7)
- Aminoacyl-tRNA biosynthesis (6)
- Androgen and estrogen metabolism (6)
- Asthma (6)
- Basal transcription factors (6)
- Folate biosynthesis (6)
- Selenoamino acid metabolism (6)
- ABC transporters (5)
- Autoimmune thyroid disease (5)
- C21-Steroid hormone metabolism (5)
- Circadian rhythm - mammal (5)
- Fatty acid biosynthesis (5)
- Heparan sulfate biosynthesis (5)
- N-Glycan biosynthesis (5)
- Sphingolipid metabolism (5)
- Terpenoid backbone biosynthesis (5)
- leucine and isoleucine biosynthesis (5)
- Ascorbate and aldarate metabolism (4)
- Chondroitin sulfate biosynthesis (4)
- Galactose metabolism (4)
- Limonene and pinene degradation (4)
- RNA polymerase (4)
- Riboflavin metabolism (4)
- Starch and sucrose metabolism (4)
- Caffeine metabolism (3)
- D-Glutamine and D-glutamate metabolism (3)
- Glycosaminoglycan degradation (3)
- Nicotinate and nicotinamide metabolism (3)
- SNARE interactions in vesicular transport (3)
- Taurine and hypotaurine metabolism (3)
- Ether lipid metabolism (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Keratan sulfate biosynthesis (2)
- Other glycan degradation (2)
- Pantothenate and CoA biosynthesis (2)
- Pentose and glucuronate interconversions (2)
- Synthesis and degradation of ketone bodies (2)
- alpha-Linolenic acid metabolism (2)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Methane metabolism (1)
- O-Mannosyl glycan biosynthesis (1)
- One carbon pool by folate (1)
- Phenylalanine metabolism (1)
- Protein export (1)
- Sulfur metabolism (1)
- Vitamin B6 metabolism (1)