Antibodies

View as table Download

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit polyclonal anti-p15 INK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human p15 INK antibody.

DCN Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DCN

Rabbit Polyclonal Anti-IFNG Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IFNG

Rabbit Polyclonal Anti-ACVR2B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACVR2B

Rabbit Polyclonal Anti-INHBC Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human INHBC

Rabbit anti-SMAD5 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human SMAD5

BMP6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6.

SMAD1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMAD1

Rabbit Polyclonal Anti-DCN Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DCN

Rabbit Polyclonal Anti-AMH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG

Rabbit Polyclonal Anti-INHBA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human INHBA

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.

Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 362 and 426 of Inhibin beta A

Rabbit polyclonal TGFBR2 (Ab-250) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I).

Rabbit polyclonal anti-ACVL1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACVL1.

Rabbit anti-SMAD4 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMAD4

BMP4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide surrounding amino acid 395 of Human BMP-4

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit polyclonal TGFBR2 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2.

Rabbit polyclonal SMAD3-S208 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3.

Rabbit Polyclonal Anti-LEFTY2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEFTY2 antibody: synthetic peptide directed towards the N terminal of human LEFTY2. Synthetic peptide located within the following region: MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK

Rabbit Polyclonal Anti-DCN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCN antibody: synthetic peptide directed towards the N terminal of human DCN. Synthetic peptide located within the following region: IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL

Rabbit Polyclonal Anti-DEPTOR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR.

SMURF1 (66-96) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen SMURF1 antibody was raised against kLH conjugated synthetic peptide selected from the N-terminal region of human SMURF1 (aa 66-96).

Inhibin beta A (INHBA) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen This INHBA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-112 amino acids from the N-terminal region of human INHBA.

Rabbit polyclonal TTK (Ab-676) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V).

Rabbit Polyclonal ROCK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK2 antibody was raised against a 15 amino acid synthetic peptide near the center of human ROCK2.

Anti-SKP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 163 amino acids of human S-phase kinase-associated protein 1

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit anti-ROCK2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ROCK2

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

ID1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 73-101 amino acids from the Central region of Human ID1 / BHLHB24

SP1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 684-715aa) of human SP1 / TSFP1

Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1

Rabbit polyclonal anti-Cullin 1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cullin 1.

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.

Rabbit polyclonal anti-CREB-BP antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CREB-BP.

Rabbit polyclonal anti-DP-1 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human DP-1.

Rabbit polyclonal SMAD4 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4.

Rabbit Polyclonal TGFβ3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3.

Rabbit anti-TFDP1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human TFDP1

Rabbit Polyclonal Decorin Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

DP1 (TFDP1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

BMP7 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide cooresponding aa 140-190 of human BMP7

KAT3A / CBP (CREBBP) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated

AMH (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 424-451 amino acids from the Central region of human AMH

GDF6 (N-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 31-59 amino acids from the N-terminal region of Human GDF6 / BMP13

ID4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human ID4 / BHLHB27

TGF beta 1 (TGFB1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of Human TGFB1.