Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Isotypes
- IgG
Pathways
- Pathways in cancer
Filter by
Category
Target Symbol
- AKT1 (22)
- STAT1 (14)
- BAD (13)
- HDAC2 (13)
- RELA (13)
- TP53 (13)
- CASP3 (11)
- BAX (10)
- JUN (10)
- BCL2 (9)
- CASP9 (9)
- NFKBIA (9)
- BRAF (8)
- EGFR (8)
- JUP (8)
- SMAD3 (8)
- STAT3 (8)
- STAT5B (8)
- BCL2L1 (7)
- CDH1 (7)
- FOXO1 (7)
- MMP2 (7)
- MMP9 (7)
- PTEN (7)
- CCNE1 (6)
- CHUK (6)
- CTNNB1 (6)
- FGFR2 (6)
- FGFR3 (6)
- FOS (6)
- GSK3B (6)
- HDAC1 (6)
- HIF1A (6)
- PRKCA (6)
- VEGFA (6)
- WNT2B (6)
- APC (5)
- AR (5)
- BIRC5 (5)
- CCNA1 (5)
- CDK6 (5)
- CDKN2A (5)
- CSF1R (5)
- CTBP1 (5)
- CTBP2 (5)
- FH (5)
- GSTP1 (5)
- HSP90AB1 (5)
- HSP90B1 (5)
- IKBKG (5)
- JAK1 (5)
- MMP1 (5)
- NFKB1 (5)
- NOS2 (5)
- NTRK1 (5)
- PAX8 (5)
- RAF1 (5)
- WNT10A (5)
- BIRC2 (4)
- CCND1 (4)
- CDKN1A (4)
- CDKN1B (4)
- COL4A1 (4)
- CREBBP (4)
- CTNNA1 (4)
- CYCS (4)
- ERBB2 (4)
- FADD (4)
- FASLG (4)
- FGF2 (4)
- FGF4 (4)
- HSP90AA1 (4)
- IKBKB (4)
- MAPK1 (4)
- MSH6 (4)
- MTOR (4)
- NFKB2 (4)
- PDGFB (4)
- PIAS2 (4)
- PPARD (4)
- PPARG (4)
- RAD51 (4)
- RB1 (4)
- SHH (4)
- SLC2A1 (4)
- SMAD4 (4)
- TRAF2 (4)
- WNT10B (4)
- WNT3A (4)
- ABL1 (3)
- ACVR1B (3)
- ACVR1C (3)
- AKT2 (3)
- AKT3 (3)
- AXIN2 (3)
- BID (3)
- CEBPA (3)
- EGF (3)
- EP300 (3)
- FGF1 (3)
Reactivities
- Human (841)
- Mouse (641)
- Rat (535)
- Bovine (38)
- Monkey (28)
- Dog (20)
- Pig (20)
- Chicken (17)
- Rabbit (17)
- Gorilla (13)
- Hamster (13)
- Bat (11)
- Xenopus (11)
- Gibbon (10)
- Horse (10)
- Rhesus Monkey (7)
- X. tropicalis (4)
- Zebrafish (4)
- Chimpanzee (3)
- Primate (2)
- Feline (1)
- Ferret (1)
- Guinea Pig (1)
- Orang-Utan (1)
- Quail (1)
- Sheep (1)
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (820)
- Transcription Factors (245)
- ES Cell Differentiation/IPS (220)
- Transmembrane (194)
- Protein Kinase (182)
- Secreted Protein (148)
- Stem cell - Pluripotency (95)
- Adult stem cells (53)
- Protease (46)
- Cancer stem cells (43)
- Stem cell relevant signaling - JAK/STAT signaling pathway (39)
- Stem cell relevant signaling - Wnt Signaling pathway (34)
- Embryonic stem cells (33)
- Stem cell relevant signaling - DSL/Notch pathway (22)
- Induced pluripotent stem cells (21)
- Nuclear Hormone Receptor (20)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (15)
- GPCR (13)
- Phosphatase (7)