Germany
Japan
United Kingdom
China
Complement C5 (C5) (N-term) rabbit polyclonal antibody
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 253-281 amino acids from the N-terminal region of human C5. |
Antibodies
View as table Download
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
C3 rabbit polyclonal antibody, Serum
| Applications | ID, IHC, IP |
| Reactivities | Human |
| Immunogen | C3c is the major fragment resulting from the C3 cleavage by C3 convertase and factor i. It is composed of an intact beta chain bound to two fragments of the alpha chain. The protein is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit polyclonal anti-C1S antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human C1S.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. |
Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Histone H2A antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Histone H2A. |
Rabbit polyclonal Histone H3 (Ab-28) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Histone H3 around the phosphorylation site of serine 28 (R-K-SP-A-P). |
Rabbit polyclonal anti-Histone H3.1 (Ser10) antibody (Phospho-specific)
| Applications | IHC, WB |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Histone H3.1 around the phosphorylation site of serine 10 (R-K-SP-T-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY |
Histone H2A.X (H2AFX) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids 100-150 of Human Histone H2A.X. |
NMDAR2B (GRIN2B) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide mapping at the N-terminus of NMDAR2B of human origin |
Rabbit polyclonal Histone H2A (Thr121) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Histone H2A around the phosphorylation site of threonine 121 (K-K-TP-E-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CD80 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CD80 antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human CD80. The immunogen is located within amino acids 60 - 110 of CD80. |
Rabbit Polyclonal Anti-CD86 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CD86 antibody was raised against a peptide corresponding to 17 amino acids near the center of human CD86. The immunogen is located within amino acids 160 - 210 of CD86. |
Complement C4A (C4A) rabbit polyclonal antibody, Purified
| Applications | IF, IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding to amino acids 1241-1256 of C4 conjugated to Keyhole limpet Haemocyanin. |
SSB rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 331-380 of Human SSB. |
C1QC rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Pathways
- Systemic lupus erythematosus
Filter by
Category
Target Symbol
- H3-4 (19)
- HIST2H3A (14)
- HIST1H3A (10)
- H2AFX (8)
- TNF (7)
- ACTN2 (6)
- GRIN2A (4)
- HIST2H4B (4)
- IFNG (4)
- IL10 (4)
- SSB (4)
- TRIM21 (4)
- ACTN1 (3)
- ACTN3 (3)
- ACTN4 (3)
- C1QC (3)
- CD40 (3)
- H2AFZ (3)
- RO60 (3)
- C3 (2)
- C5 (2)
- C8B (2)
- CD80 (2)
- FCGR2B (2)
- GRIN2B (2)
- HIST1H2AI (2)
- HLA-DMB (2)
- HLA-DPB1 (2)
- C1QB (1)
- C1R (1)
- C1S (1)
- C2 (1)
- C4A (1)
- C6 (1)
- C7 (1)
- C9 (1)
- CD40LG (1)
- CD86 (1)
- CTSG (1)
- FCGR3A (1)
- H2BC21 (1)
- H3C1 (1)
- H3F3B (1)
- H4C14 (1)
- HIST1H2AB (1)
- HIST1H2AH (1)
- HIST1H2BH (1)
- HIST1H3D (1)
- HIST4H4 (1)
- HLA-DMA (1)
- HLA-DOA (1)
- HLA-DRB5 (1)
- SNRPD1 (1)
- SNRPD3 (1)