Antibodies

View as table Download

Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus.

Rabbit anti-CXCR3 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CXCR3

Rabbit Polyclonal Anti-OR51E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK

Rabbit Polyclonal Anti-P2Y1 Receptor (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide SDEYLRSYFIYSMC, corresponding to amino acid residues 207-220 of human P2Y1 Receptor. 2nd extracellular loop.

Glucagon Receptor (GCGR) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 100-150 of Human Glucagon Receptor.

Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum

Applications ELISA, IF, IHC, WB
Reactivities Rat
Immunogen D2s (Ac239-Cys247) covalently attached to a carrier protein

Rabbit Polyclonal Anti-ADORA2B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B.

Rabbit Polyclonal S1P1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1.

Rabbit Polyclonal Anti-GPR161 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: SISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLE

Rabbit Polyclonal Anti-CASR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CASR antibody was raised against a 15 amino acid peptide near the amino terminus of human CASR.

Rabbit Polyclonal Anti-TRIP12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRIP12 antibody was raised against a 18 amino acid peptide near the carboxy terminus of human TRIP12.

5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Encephalopsin (OPN3) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide corresponding to amino acids 176-220 of Human Encephalopsin.

P2Y9 (LPAR4) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 127-156 amino acids from the Central region of human P2RY9 / LPAR4

Rabbit Polyclonal Anti-P2Y12 Receptor (extracellular)

Applications FC, IF, WB
Reactivities Human, Rat
Immunogen Peptide CTAENTLFYVKES, corresponding to amino acid residues 270-282 of human P2Y12 receptor. 3rd extracellular loop.

LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated

P2RY5 (LPAR6) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen KLH conjugated synthetic peptide between 106-134 amino acids from the Central region of Human P2RY5 / LPAR6

Rabbit Polyclonal CX3CR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1.

LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated

Mu Opioid Receptor (OPRM1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Porcine, Rat
Immunogen KLH conjugated synthetic peptide between 161-187 amino acids from the Center region of human OPRM1

5 HT 2A (HTR2A) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal CXCR4 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4.

Rabbit Polyclonal AGTR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1.

Rabbit polyclonal anti-SPR1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SPR1.

Rabbit anti-SIGMAR1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIGMAR1

Rabbit Polyclonal CCR1 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was raised against a synthetic peptide of human CCR1 protein.

Rabbit Polyclonal Anti-FZD9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF

Rabbit Polyclonal Anti-CALCRL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL

GPR40 (FFAR1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 201-250 of Human GPR40.

Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093)

Rabbit Polyclonal MAS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human MAS1 protein (between residues 75-125) [UniProt P04201]

Rabbit polyclonal anti-FZD2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD2.

Rabbit polyclonal anti-FZD9 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9.

Rabbit polyclonal Encephalopsin antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Encephalopsin.

Rabbit Polyclonal GLP-1R Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human GLP1R protein (between residues 250-350) [UniProt P43220]

Rabbit Polyclonal Anti-GPR68 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the middle region of Human GPR68. Synthetic peptide located within the following region: SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL

Rabbit Polyclonal Anti-GPR52 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-LOC684623 antibody is: synthetic peptide directed towards the middle region of Rat LOC684623. Synthetic peptide located within the following region: RARFPSHEVDASREAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESS

ACKR3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 330-358 amino acids from the C-terminal region of Human CXCR7.

Rabbit Polyclonal Antibody against OPRS1 (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This OPRS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 47-81 amino acids from the N-terminal region of human OPRS1.

Rabbit Polyclonal CCR3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CCR3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human CCR3.

Rabbit Polyclonal GPR3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GPR3 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human GPR3.

Rabbit Polyclonal MC4R Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MC4R antibody was raised against a 19 amino acid peptide near the amino terminus of human MC4R.

Rabbit polyclonal anti-CRHR1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CRHR1.

Rabbit polyclonal CALCR Antibody (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CALCR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 445-474 amino acids from the C-terminal region of human CALCR.

Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus.

Rabbit Polyclonal Anti-Melanocortin Receptor 4 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HRGMHTSLHLWNRSS, corresponding to amino acid residues 6-20 of human MC4R. Extracellular, N terminal.

Rabbit Polyclonal Anti-P2Y12 Receptor

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KTTRPFKTSNPKNLLGAK,corresponding to amino acid residues 125-142 of human P2Y12 receptor.Intracellular, 2nd Cytoplasmic loop.

Rabbit Polyclonal Anti-FZD4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV

Rabbit Polyclonal Anti-TSHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: LTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPS

Rabbit Polyclonal Anti-AGTR1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI