Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Anti-SEPT2 Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the N terminal of human SEPT2. Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK |
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Rabbit polyclonal antibody to HN1 (hematological and neurological expressed 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 166 of HN1 (Uniprot ID#Q9UK76 isoform2) |
Rabbit Polyclonal Anti-HSD3B1 Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
FBL Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FBL |
Rabbit polyclonal anti-PCNA antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PCNA |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit polyclonal GOT2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Rabbit anti-S100A10 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human S100A10 |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
USD 415.00
In Stock
Rabbit polyclonal Vimentin Antibody (S82)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 63-90 amino acids from human Vimentin. |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit polyclonal HSP90B1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1. |
ARHGEF7 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ARHGEF7 |
Rabbit Polyclonal PRCC Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Ku80 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal LIM1 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Active filters
Reactivities
- Monkey
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Filter by
Category
Target Symbol
- PCNA (4)
- TP53 (4)
- HSP90AB1 (3)
- STIP1 (3)
- ANXA5 (2)
- ENO1 (2)
- FBL (2)
- GAPDH (2)
- HSP90B1 (2)
- MAT2A (2)
- MELTF (2)
- NCL (2)
- PKM (2)
- POU5F1 (2)
- RAB9A (2)
- SLC6A3 (2)
- SRD5A2 (2)
- UCHL1 (2)
- VIM (2)
- AAMP (1)
- AAPK1 (1)
- ABCB1 (1)
- ACTN1 (1)
- ACTR3 (1)
- AIFM2 (1)
- AIP (1)
- AK1 (1)
- AKR1C1 (1)
- AKT2 (1)
- ALDOB (1)
- ANXA1 (1)
- ANXA7 (1)
- APP (1)
- ARHGEF7 (1)
- ATP5PF (1)
- ATR (1)
- BSG (1)
- CASP3 (1)
- CASP7 (1)
- CCL2 (1)
- CCNA1 (1)
- CCNA2 (1)
- CCNB1 (1)
- CD1B (1)
- CD1D (1)
- CD36 (1)
- CD38 (1)
- CD40 (1)
- CDC26 (1)
- CLGN (1)
- CNOT7 (1)
- COX7B2 (1)
- CRYBA4 (1)
- CTCF (1)
- CYP11B1 (1)
- CYP17A1 (1)
- CYP19A1 (1)
- CYP1B1 (1)
- CYP21A2 (1)
- DDX39A (1)
- EGLN1 (1)
- EIF2S1 (1)
- EIF3E (1)
- ETFB (1)
- F7 (1)
- F9 (1)
- FBXW11 (1)
- FOS (1)
- FPGT (1)
- FPGT-TNNI3K (1)
- FSCN1 (1)
- GANAB (1)
- GCLM (1)
- GK2 (1)
- GLI3 (1)
- GOT2 (1)
- GPR132 (1)
- GSTA2 (1)
- H4C1 (1)
- HCK (1)
- HDAC2 (1)
- HIF1A (1)
- HSD3B1 (1)
- HSD3B2 (1)
- HSP90AA1 (1)
- HSPA5 (1)
- HSPBP1 (1)
- ICAM2 (1)
- IDH1 (1)
- IGF1R (1)
- IGF2BP2 (1)
- IKBKB (1)
- IL1R2 (1)
- IL4 (1)
- ING1 (1)
- JPT1 (1)
- KIT (1)
- LHX1 (1)
- LRP12 (1)
- MAPK3 (1)
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (97)
- Stem cell - Pluripotency (25)
- Transmembrane (22)
- Transcription Factors (21)
- ES Cell Differentiation/IPS (14)
- Protease (8)
- Secreted Protein (6)
- P450 (5)
- Cancer stem cells (4)
- Adult stem cells (3)
- Embryonic stem cells (3)
- Induced pluripotent stem cells (3)
- Protein Kinase (3)
- Ion Channels: Other (1)
- Nuclear Hormone Receptor (1)
- Phosphatase (1)
Pathways
- Metabolic pathways (32)
- Pathways in cancer (17)
- Cell cycle (13)
- Prostate cancer (12)
- Huntington's disease (11)
- Alzheimer's disease (10)
- Parkinson's disease (10)
- Progesterone-mediated oocyte maturation (9)
- Glycolysis / Gluconeogenesis (8)
- NOD-like receptor signaling pathway (8)
- Colorectal cancer (7)
- MAPK signaling pathway (7)
- p53 signaling pathway (7)
- Androgen and estrogen metabolism (6)
- Hematopoietic cell lineage (6)
- Apoptosis (5)
- C21-Steroid hormone metabolism (5)
- Chronic myeloid leukemia (5)
- DNA replication (5)
- Mismatch repair (5)
- Regulation of actin cytoskeleton (5)
- Amyotrophic lateral sclerosis (ALS) (4)
- Antigen processing and presentation (4)
- Basal cell carcinoma (4)
- Base excision repair (4)
- Bladder cancer (4)
- Calcium signaling pathway (4)
- Chemokine signaling pathway (4)
- Cytokine-cytokine receptor interaction (4)
- Endometrial cancer (4)
- Glioma (4)
- Glutathione metabolism (4)
- Melanoma (4)
- Neurotrophin signaling pathway (4)
- Non-small cell lung cancer (4)
- Nucleotide excision repair (4)
- Oocyte meiosis (4)
- PPAR signaling pathway (4)
- Pancreatic cancer (4)
- Thyroid cancer (4)
- Wnt signaling pathway (4)
- Cysteine and methionine metabolism (3)
- Fc gamma R-mediated phagocytosis (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- Natural killer cell mediated cytotoxicity (3)
- Oxidative phosphorylation (3)
- Pathogenic Escherichia coli infection (3)
- Prion diseases (3)
- Purine metabolism (3)
- Renal cell carcinoma (3)
- Ribosome (3)
- Small cell lung cancer (3)
- T cell receptor signaling pathway (3)
- Toll-like receptor signaling pathway (3)
- Ubiquitin mediated proteolysis (3)
- Adherens junction (2)
- Adipocytokine signaling pathway (2)
- Allograft rejection (2)
- Arginine and proline metabolism (2)
- Asthma (2)
- Autoimmune thyroid disease (2)
- B cell receptor signaling pathway (2)
- Basal transcription factors (2)
- Caffeine metabolism (2)
- Cardiac muscle contraction (2)
- Cell adhesion molecules (CAMs) (2)
- Citrate cycle (TCA cycle) (2)
- Complement and coagulation cascades (2)
- Drug metabolism - other enzymes (2)
- Fc epsilon RI signaling pathway (2)
- Focal adhesion (2)
- Fructose and mannose metabolism (2)
- Gap junction (2)
- Hedgehog signaling pathway (2)
- Insulin signaling pathway (2)
- Jak-STAT signaling pathway (2)
- Leukocyte transendothelial migration (2)
- Pyruvate metabolism (2)
- RNA degradation (2)
- Selenoamino acid metabolism (2)
- Systemic lupus erythematosus (2)
- Tight junction (2)
- Type II diabetes mellitus (2)
- VEGF signaling pathway (2)
- Viral myocarditis (2)
- mTOR signaling pathway (2)
- ABC transporters (1)
- Acute myeloid leukemia (1)
- Alanine (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Axon guidance (1)
- Dorso-ventral axis formation (1)
- Drug metabolism - cytochrome P450 (1)
- ECM-receptor interaction (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Glycerolipid metabolism (1)
- GnRH signaling pathway (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Melanogenesis (1)
- N-Glycan biosynthesis (1)
- Nicotinate and nicotinamide metabolism (1)
- Non-homologous end-joining (1)
- Notch signaling pathway (1)
- One carbon pool by folate (1)
- Pentose phosphate pathway (1)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Primary immunodeficiency (1)
- Pyrimidine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Sphingolipid metabolism (1)
- TGF-beta signaling pathway (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- Vascular smooth muscle contraction (1)
- aspartate and glutamate metabolism (1)
- tyrosine and tryptophan biosynthesis (1)