Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Rabbit polyclonal SNAI1 (Ser246) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human: Ser246, Mouse: Ser246 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M). |
| Modifications | Phospho-specific |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal Anti-TJP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS |
Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit Polyclonal Anti-TGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Rabbit Polyclonal Anti-ACP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
Rabbit polyclonal anti-Vinculin antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VCL |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the C terminal of human ACTN4. Synthetic peptide located within the following region: DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-PVRL2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PVRL2 |
Rabbit anti-CTNNA1 Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTNNA1 |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
Rabbit polyclonal SMAD4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4. |
Rabbit Polyclonal MAP3K7 (Thr187) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MAP3K7 around the phosphorylation site of Threonine 187 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Src (Tyr418) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 418 |
| Modifications | Phospho-specific |
Active filters
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Adherens junction
Filter by
Category
Target Symbol
- EGFR (35)
- CTNNB1 (18)
- SMAD3 (18)
- ERBB2 (17)
- SMAD2 (14)
- MET (13)
- IGF1R (12)
- SRC (12)
- MAPK1 (11)
- MAP3K7 (10)
- SHC1 (10)
- FGFR1 (9)
- MAPK3 (9)
- VCL (9)
- FYN (8)
- SNAI1 (8)
- TCF7 (8)
- CTNND1 (7)
- RHOA (7)
- SMAD4 (7)
- TGFBR2 (7)
- CTNNA1 (6)
- EP300 (6)
- ACTN1 (5)
- ACTN4 (5)
- CSNK2A1 (5)
- FER (5)
- INSR (5)
- PTPN6 (5)
- CDC42 (4)
- CDH1 (4)
- CREBBP (4)
- LEF1 (4)
- RAC1 (4)
- TGFBR1 (4)
- TJP1 (4)
- ACVR1B (3)
- CSNK2A2 (3)
- NECTIN2 (3)
- NECTIN3 (3)
- NLK (3)
- PTPN1 (3)
- SNAI2 (3)
- TCF7L1 (3)
- WAS (3)
- WASF3 (3)
- ACP1 (2)
- ACVR1C (2)
- BAIAP2 (2)
- CSNK2B (2)
- NECTIN1 (2)
- TCF7L2 (2)
- WASF1 (2)
- WASF2 (2)
- YES1 (2)
- AFDN (1)
- CTNNA2 (1)
- NECTIN4 (1)
- PTPRJ (1)
- PTPRM (1)
- RAC2 (1)
- SORBS1 (1)
- WASL (1)