Antibodies

View as table Download

Rabbit Polyclonal Lipase A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Lysosomal acid lipase protein (within residues 150-300). [Swiss-Prot P38571]

Rabbit Polyclonal ASAH1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1.

Rabbit Polyclonal Anti-CTSL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CTSL

Rabbit Polyclonal Anti-LAMP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human LAMP2

Rabbit Polyclonal Anti-NEU1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG

Rabbit Polyclonal antibody to GALNS (galactosamine (N-acetyl)-6-sulfate sulfatase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 20 and 259 of GALNS

Rabbit polyclonal GC Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC.

Rabbit anti-PSAP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSAP

Rabbit polyclonal antibody to beta-Gal (galactosidase, beta 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 166 and 677 of beta-Gal (Uniprot ID#P16278)

Rabbit Polyclonal antibody to GBA (glucosidase, beta, acid)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 352 and 536 of GBA (Uniprot ID#P04062)

Cathepsin K Rabbit anti-Rat Polyclonal Antibody

Applications IHC
Reactivities Chicken, Human, Mouse, Rabbit, Rat, Pig
Conjugation Unconjugated
Immunogen CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K.

Rabbit anti-GLB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLB1

Rabbit Polyclonal Anti-ARSA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARSA antibody: synthetic peptide directed towards the N terminal of human ARSA. Synthetic peptide located within the following region: DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR

Rabbit Polyclonal Anti-ARSA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARSA antibody: synthetic peptide directed towards the middle region of human ARSA. Synthetic peptide located within the following region: KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH

Rabbit Polyclonal Niemann-Pick C1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine, Hamster, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118]

Rabbit polyclonal anti-LAMP2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 403 of rat LAMP2

Rabbit Polyclonal Cathepsin V Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal LAMP-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen LAMP-2 antibody was raised against a 17 amino acid synthetic peptide from near the carboxy terminus of human LAMP-2. The immunogen is located within the last 50 amino acids of LAMP-2.

Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 318 and 496 of SGSH (Uniprot ID#P51688)

Rabbit polyclonal antibody to beta-glucosidase (glucosidase, beta; acid (includes glucosylceramidase))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 65 and 384 of GBA (Uniprot ID#P04062)

Rabbit polyclonal IGF2R (Ser2409) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IGF2R around the phosphorylation site of serine 2409 (Q-D-SP-E-D).
Modifications Phospho-specific

Rabbit polyclonal anti-IGF2R antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human IGF2R.

ARSA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human ARSA

Rabbit anti-CTSD Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant Protein of human CTSD

Rabbit anti-GALNS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GALNS

Rabbit Polyclonal Anti-ASAH1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASAH1 antibody: synthetic peptide directed towards the N terminal of human ASAH1. Synthetic peptide located within the following region: MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY

Rabbit Polyclonal Anti-SGSH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SGSH antibody is: synthetic peptide directed towards the N-terminal region of Human SGSH. Synthetic peptide located within the following region: RNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSCSP

Rabbit Polyclonal Cathepsin D Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

beta glucuronidase (GUSB) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Porcine
Immunogen KLH conjugated synthetic peptide between 335 - 362 amino acids from the Center region of Human Beta-glucuronidase

Rabbit Polyclonal NPC1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen NPC1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human NPC1.

Rabbit polyclonal antibody to TRAP (acid phosphatase 5, tartrate resistant)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 28 and 325 of TRAP (Uniprot ID#P13686)

Rabbit polyclonal antibody to AP1S2 (adaptor-related protein complex 1, sigma 2 subunit)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 157 of AP1S2 (Uniprot ID#P56377)

Rabbit polyclonal anti-ARSA antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARSA.

Rabbit polyclonal anti-GUSB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GUSB.

Cathepsin K Rabbit anti-Rat Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K.

Rabbit polyclonal GALNS Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GALNS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-263 amino acids from the Central region of human GALNS.

Rabbit anti-CTSH Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CTSH

Rabbit anti-HEXA Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HEXA

Rabbit Polyclonal Anti-GAA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL

Rabbit Polyclonal Anti-ASAH1 Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ASAH1 antibody: synthetic peptide directed towards the middle region of human ASAH1. Synthetic peptide located within the following region: QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP

Rabbit Polyclonal Anti-ACP5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP5 antibody: synthetic peptide directed towards the N terminal of human ACP5. Synthetic peptide located within the following region: DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ

Rabbit Polyclonal Anti-SGSH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SGSH antibody is: synthetic peptide directed towards the C-terminal region of Human SGSH. Synthetic peptide located within the following region: ARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAP

Rabbit Polyclonal Anti-Cathepsin G Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cathepsin G Antibody: A synthesized peptide derived from human Cathepsin G

Cathepsin K (CTSK) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Bovine, Human, Monkey, Porcine, Rabbit
Immunogen KLH conjugated synthetic peptide between aa 207-27 from the Center region of human CTSK.

Galactosidase alpha (GLA) (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 90~120 amino acids from the N-terminal region of human GLA

Cathepsin E (CTSE) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 260-310 of Human Cathepsin E.

LIMPII (SCARB2) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen SCARB2 antibody was raised against 16 amino acid peptide from near the center of human LIMP2

IGF2R (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

Cathepsin V (CTSV) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from human CATL2.