Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
GRIA1 (264-277) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_000818.2; NP_001107655.1. |
Rabbit Polyclonal Bcl2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone 2C8, Aff - Purified
| Applications | ELISA, FN |
| Reactivities | Human |
Catalase (CAT) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | HRP |
TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI11F8
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI5C8
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI2D1
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI1E7
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI3F8
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI3E4
Active filters
Applications
- ELISA
Pathways
- Amyotrophic lateral sclerosis (ALS)