Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal TACE Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid. |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Rabbit Polyclonal Anti-GNL3L Antibody - N-terminal region
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNL3L antibody: synthetic peptide directed towards the N terminal of human GNL3L. Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Rabbit polyclonal HtrA1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HtrA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 116-147 amino acids from the N-terminal region of human HtrA1. |
Plasminogen (PLG) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Plasminogen (PLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, HRP
| Applications | ELISA, ID, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | HRP |
| Immunogen | The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IHC, IP, WB |
| Reactivities | Monkey |
| Conjugation | Biotin |
| Immunogen | Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from rhesus monkey milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP, WB |
| Reactivities | Monkey |
| Conjugation | FITC |
| Immunogen | Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight antimicrobial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from monkey milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, HRP
| Applications | ELISA, ID, IF, IHC, IP, WB |
| Reactivities | Monkey |
| Conjugation | HRP |
| Immunogen | Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from rhesus monkey milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal FLIP Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FLIP antibody was raised against a peptide corresponding to amino acids near the C-terminus of human FLIPaFLIPl form. The immunogen is located within the last 50 amino acids of FLIP. |
Rabbit polyclonal antibody to MALT1 (mucosa associated lymphoid tissue lymphoma translocation gene 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 341 and 609 of MALT1 (Uniprot ID#Q9UDY8) |
Rabbit polyclonal PCSK2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PCSK2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 87-116 amino acids from the N-terminal region of human PCSK2. |
AHNAK guinea pig polyclonal antibody, Serum
| Applications | IF, IHC, IP, WB |
| Reactivities | Bovine, Human |
| Immunogen | Synthetic peptides of Human Desmoyokin (D1a/b, D2a/b, D4a/b), coupled to KLH |
Lactoferrin (LTF) goat polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, WB |
| Reactivities | Human |
| Immunogen | Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, WB |
| Reactivities | Monkey |
| Immunogen | Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from rhesus monkey milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal FLIP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | FLIP antibody was raised against a 19 amino acid peptide near the carboxy terminus of human FLIP. The immunogen is located within amino acids 180 - 230 of FLIP. |
Rabbit anti-HTRA2 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HTRA2 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IF
Clonalities
- Polyclonal
Families
- Protease
Filter by
Target Symbol
- LTF (9)
- CASP9 (8)
- UCHL1 (6)
- CFLAR (5)
- CASP8 (4)
- CASP6 (3)
- HTRA2 (3)
- PLG (3)
- TMPRSS3 (3)
- ATG4A (2)
- ATG4B (2)
- ATG4C (2)
- BRCC3 (2)
- CAPN5 (2)
- CASP4 (2)
- CTSD (2)
- DPP3 (2)
- DPP8 (2)
- EPHX1 (2)
- FREM1 (2)
- GZMH (2)
- GZMK (2)
- MALT1 (2)
- MMP2 (2)
- PARK7 (2)
- PSMA6 (2)
- USP10 (2)
- USP15 (2)
- USP25 (2)
- ACY1 (1)
- ADAM10 (1)
- ADAM17 (1)
- AHNAK (1)
- BACE1 (1)
- C2 (1)
- CAPN6 (1)
- CASP1 (1)
- CASP10 (1)
- CASP2 (1)
- CASP3 (1)
- CASP5 (1)
- CPB1 (1)
- CRBN (1)
- CTSB (1)
- CTSV (1)
- ERAP1 (1)
- ERAP2 (1)
- ESPL1 (1)
- F10 (1)
- GGH (1)
- GNL3L (1)
- HP (1)
- HTRA1 (1)
- KLK11 (1)
- LNPEP (1)
- MBTPS2 (1)
- MME (1)
- MMP1 (1)
- MMP10 (1)
- MMP11 (1)
- MMP3 (1)
- MMP9 (1)
- NPEPPS (1)
- NTPCR (1)
- OTUB1 (1)
- OTUD5 (1)
- PAPPA2 (1)
- PARL (1)
- PCSK2 (1)
- PM20D2 (1)
- PRSS12 (1)
- PSEN1 (1)
- PSMA2 (1)
- PSMB8 (1)
- SENP2 (1)
- SENP3 (1)
- ST14 (1)
- TPP1 (1)
- XPNPEP3 (1)
Reactivities
Antibody Hosts
Conjugates
Modifications
Pathways
- Apoptosis (22)
- Parkinson's disease (20)
- Alzheimer's disease (18)
- Pathways in cancer (17)
- Huntington's disease (13)
- Viral myocarditis (13)
- p53 signaling pathway (13)
- Amyotrophic lateral sclerosis (ALS) (10)
- Colorectal cancer (9)
- Endometrial cancer (8)
- Non-small cell lung cancer (8)
- Pancreatic cancer (8)
- Prostate cancer (8)
- Small cell lung cancer (8)
- VEGF signaling pathway (8)
- NOD-like receptor signaling pathway (6)
- RIG-I-like receptor signaling pathway (6)
- Regulation of autophagy (6)
- Complement and coagulation cascades (5)
- Lysosome (5)
- Bladder cancer (4)
- Proteasome (4)
- Toll-like receptor signaling pathway (4)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- Leukocyte transendothelial migration (3)
- Neuroactive ligand-receptor interaction (3)
- B cell receptor signaling pathway (2)
- GnRH signaling pathway (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Notch signaling pathway (2)
- Renin-angiotensin system (2)
- T cell receptor signaling pathway (2)
- Wnt signaling pathway (2)
- Antigen processing and presentation (1)
- Arginine and proline metabolism (1)
- Cell cycle (1)
- Cytosolic DNA-sensing pathway (1)
- Folate biosynthesis (1)
- Hematopoietic cell lineage (1)
- MAPK signaling pathway (1)
- Metabolic pathways (1)
- Natural killer cell mediated cytotoxicity (1)
- Neurotrophin signaling pathway (1)
- Oocyte meiosis (1)
- PPAR signaling pathway (1)
- Systemic lupus erythematosus (1)