Germany
Japan
United Kingdom
China
Antibodies
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
TGF beta Receptor I (TGFBR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 150-200 of Human TGFβ RI. |
Thermolysin rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bacillus sp. |
| Immunogen | Thermolysin isolated and purified from Bacillus thermoproteolyticus rokko. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Procollagen Type III rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bovine, Human, Porcine |
| Immunogen | Purified Human Procollagen type III C-terminal and N-terminal PIIICP separated. |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rotavirus (NCDV) goat polyclonal antibody, FITC
| Applications | IF |
| Conjugation | FITC |
| Immunogen | Bovine Rotavirus (Nebraska Calf Diarrhoea Virus) |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-HNRPA0 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Lyve1 rabbit polyclonal antibody, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Immunogen | Highly pure recombinant Mouse soluble LYVE-1 (Ala24-Gly228) produced in insect cells (Cat.-No DA3524). This recombinant soluble LYVE-1 consists of amino acid 24 (Ala) to 228 (Gly) and is fused to a C-terminal His-tag (6xHis). |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit Polyclonal H3K9me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit Polyclonal H3K27me3S28p Antibody
| Applications | Dot, ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me3S28p antibody: histone H3 containing the trimethylated lysine 27 and the phosphorylated serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3S10p Antibody
| Applications | Dot, ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K27me3 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me3 antibody: against histone H3, trimethylated at lysine 27 (H3K27me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
TDH1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | Glyceraldehyde-3-Phosphate Dehydrogenase isolated and purified from Baker's Yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
HRH2 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF |
| Reactivities | Canine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the C-Terminus of the protein sequence according to NP_071640.1; NP_001124527.1. |
Rabbit Polyclonal Anti-HNRPL Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
Rabbit Polyclonal H3K36me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K36me2 antibody: histone H3 containing the dimethylated lysine 36 (H3K36me2), using a KLH-conjugated synthetic peptide. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IF
Clonalities
- Polyclonal
Filter by
Target Symbol
- H3C1 (30)
- C3 (21)
- ALB (20)
- COL1A1 (20)
- GAPDH (18)
- HISTONE H3 (18)
- AKT1 (17)
- RPS6KB1 (16)
- HIST2H3A (15)
- IRS1 (14)
- MAPT (14)
- SNCA (13)
- STAT3 (13)
- BAX (12)
- SQSTM1 (12)
- TP53 (12)
- GFAP (11)
- RELA (11)
- TH (11)
- CANX (10)
- CASP9 (10)
- FOXO1 (10)
- GJA1 (10)
- MAP1LC3B (10)
- MAPK8 (10)
- RB1 (10)
- RPS6 (10)
- BCL2 (9)
- CCNB1 (9)
- CTNNB1 (9)
- ENO2 (9)
- FOXO4 (9)
- GAP43 (9)
- LDHA (9)
- LTF (9)
- MDH1 (9)
- MYC (9)
- PTK2 (9)
- VIM (9)
- EGFR (8)
- HSPD1 (8)
- IRF3 (8)
- KDR (8)
- NTRK1 (8)
- RPS6KA1 (8)
- SMAD2 (8)
- STMN1 (8)
- SYT1 (8)
- TARDBP (8)
- ACTB (7)
- AKT2 (7)
- APP (7)
- ATG7 (7)
- BRCA1 (7)
- CASP3 (7)
- COL4A1 (7)
- COL5A1 (7)
- HIST1H3A (7)
- HISTONE H4 (7)
- HSPA5 (7)
- IKBKG (7)
- JUN (7)
- KDM1A (7)
- MTOR (7)
- NFKBIA (7)
- NOS3 (7)
- PAK1 (7)
- PDGFRB (7)
- PKM (7)
- SYN1 (7)
- ATG5 (6)
- CA1 (6)
- CASP8 (6)
- CBX5 (6)
- CDKN2A (6)
- CFLAR (6)
- COL1A2 (6)
- COL2A1 (6)
- COL7A1 (6)
- CREB1 (6)
- FASN (6)
- GRIN2B (6)
- GSK3B (6)
- HDAC1 (6)
- HDAC5 (6)
- HDAC6 (6)
- HSP90AB1 (6)
- IKBKB (6)
- KLF4 (6)
- LAMP1 (6)
- LDHB (6)
- LYZ (6)
- MAPK14 (6)
- MEF2A (6)
- MET (6)
- MKI67 (6)
- NBN (6)
- NPM1 (6)
- PECAM1 (6)
- PXN (6)
Reactivities
- Human (7292)
- Mouse (5815)
- Rat (4771)
- Bovine (359)
- Monkey (144)
- Chicken (137)
- Pig (133)
- Rhesus Monkey (101)
- Xenopus (92)
- Zebrafish (72)
- Dog (64)
- Canine (62)
- X. tropicalis (58)
- Primate (50)
- Chimpanzee (43)
- Hamster (43)
- Rabbit (40)
- Porcine (29)
- Cow (28)
- Feline (24)
- Sheep (24)
- Mammalian (20)
- C. elegans (13)
- Guinea Pig (13)
- Drosophila (11)
- SARS-CoV-2 (7)
- Avian (5)
- Broad (5)
- Goat (5)
- Fish (4)
- Coral (2)
- Equine (2)
- Fusion proteins containing the Flag Tag (2)
- Beluga (1)
- Birds (1)
- Carp (1)
- Dogfish (1)
- Frog (1)
- Fungus (1)
- Hagfish (1)
- Horse (1)
- Invertebrate (1)
- Medaka fish (1)
- Mink (1)
- Mustelid (1)
- Orang-Utan (1)
- Quail (1)
- SARS-CoV (1)
- SimianIVE (1)
- Staphylococcus aureus (1)
- Streptococcus Pyogenes (1)
- Tobacco (1)
- Tomato (1)
- Yeast (1)
Antibody Hosts
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (2518)
- Phospho-specific (141)
- Acetyl K5 (3)
- Acetyl K12 (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K16 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K29 (1)
- Acetyl K36 (1)
- Acetyl K4 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S2056 (1)
- Phospho S241 (1)
- Phospho S2448 (1)
- Phospho S28 (1)
- Phospho S428 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S519/T522 (1)
- Phospho S70 (1)
- Phospho S9 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T180/Y182 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T389 (1)
- Phospho T395 (1)
- Phospho T45 (1)
- Phospho T498 (1)
- Phospho T6 (1)
- Phospho T91 (1)
- Phospho Y1022/1023 (1)
- Phospho Y15 (1)
- Phospho Y705 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
Assay Types
Families
- Druggable Genome (3016)
- Transmembrane (1352)
- Transcription Factors (705)
- Protein Kinase (416)
- Secreted Protein (366)
- ES Cell Differentiation/IPS (315)
- Stem cell - Pluripotency (242)
- GPCR (240)
- Protease (134)
- Embryonic stem cells (64)
- Adult stem cells (55)
- Induced pluripotent stem cells (47)
- Nuclear Hormone Receptor (41)
- Phosphatase (34)
- Stem cell relevant signaling - JAK/STAT signaling pathway (32)
- Cancer stem cells (30)
- Ion Channels: Other (28)
- P450 (25)
- Ion Channels: Glutamate Receptors (21)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (18)
- Ion Channels: Transient receptor potential (17)
- Stem cell relevant signaling - DSL/Notch pathway (13)
- Stem cell relevant signaling - Wnt Signaling pathway (13)
- Ion Channels: Potassium (12)
- Ion Channels: ATP Receptors (5)
- Ion Channels: Cys-loop Receptors (4)
- Ion Channels: Cyclic nucleotide gated (3)
- Ion Channels: Calcium (2)
Pathways
- Pathways in cancer (420)
- Metabolic pathways (327)
- Focal adhesion (231)
- MAPK signaling pathway (219)
- Neuroactive ligand-receptor interaction (202)
- Neurotrophin signaling pathway (183)
- Prostate cancer (166)
- Cytokine-cytokine receptor interaction (162)
- Insulin signaling pathway (155)
- Chemokine signaling pathway (153)
- Colorectal cancer (153)
- Small cell lung cancer (151)
- Apoptosis (147)
- Regulation of actin cytoskeleton (144)
- Cell cycle (139)
- Chronic myeloid leukemia (135)
- Toll-like receptor signaling pathway (135)
- ErbB signaling pathway (133)
- Alzheimer's disease (128)
- Pancreatic cancer (123)
- Adipocytokine signaling pathway (117)
- T cell receptor signaling pathway (117)
- Wnt signaling pathway (117)
- Calcium signaling pathway (114)
- Endocytosis (114)
- Huntington's disease (109)
- Olfactory transduction (107)
- Leukocyte transendothelial migration (105)
- Acute myeloid leukemia (104)
- Progesterone-mediated oocyte maturation (102)
- Endometrial cancer (99)
- Melanoma (96)
- Glioma (95)
- Jak-STAT signaling pathway (94)
- Non-small cell lung cancer (94)
- RIG-I-like receptor signaling pathway (93)
- p53 signaling pathway (93)
- Amyotrophic lateral sclerosis (ALS) (92)
- NOD-like receptor signaling pathway (92)
- Systemic lupus erythematosus (92)
- Fc gamma R-mediated phagocytosis (90)
- Oocyte meiosis (89)
- VEGF signaling pathway (89)
- mTOR signaling pathway (89)
- Axon guidance (85)
- B cell receptor signaling pathway (82)
- Renal cell carcinoma (82)
- Adherens junction (80)
- Natural killer cell mediated cytotoxicity (78)
- Parkinson's disease (78)
- Gap junction (75)
- Epithelial cell signaling in Helicobacter pylori infection (74)
- Melanogenesis (73)
- Tight junction (72)
- ECM-receptor interaction (71)
- Bladder cancer (69)
- Ubiquitin mediated proteolysis (69)
- TGF-beta signaling pathway (67)
- Pathogenic Escherichia coli infection (66)
- Fc epsilon RI signaling pathway (61)
- GnRH signaling pathway (58)
- Type II diabetes mellitus (58)
- Glycolysis / Gluconeogenesis (57)
- Long-term potentiation (55)
- Antigen processing and presentation (54)
- Cytosolic DNA-sensing pathway (54)
- Vascular smooth muscle contraction (54)
- Basal cell carcinoma (50)
- Hematopoietic cell lineage (50)
- Thyroid cancer (50)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (47)
- Viral myocarditis (47)
- Cell adhesion molecules (CAMs) (45)
- Long-term depression (40)
- Purine metabolism (40)
- Regulation of autophagy (40)
- Hypertrophic cardiomyopathy (HCM) (38)
- Notch signaling pathway (38)
- Dilated cardiomyopathy (37)
- Complement and coagulation cascades (35)
- Prion diseases (34)
- Spliceosome (33)
- Lysosome (32)
- Vibrio cholerae infection (31)
- Hedgehog signaling pathway (30)
- PPAR signaling pathway (29)
- Oxidative phosphorylation (28)
- RNA degradation (28)
- Primary immunodeficiency (27)
- Pyruvate metabolism (27)
- Arginine and proline metabolism (26)
- Phosphatidylinositol signaling system (26)
- Metabolism of xenobiotics by cytochrome P450 (25)
- Citrate cycle (TCA cycle) (24)
- Ribosome (24)
- Base excision repair (23)
- Type I diabetes mellitus (22)
- Arachidonic acid metabolism (19)
- Drug metabolism - cytochrome P450 (19)
- Inositol phosphate metabolism (19)
- Tyrosine metabolism (19)
- Maturity onset diabetes of the young (18)
- Retinol metabolism (18)
- Cardiac muscle contraction (17)
- Glutathione metabolism (17)
- Glycerolipid metabolism (17)
- Glycerophospholipid metabolism (17)
- Homologous recombination (17)
- Pyrimidine metabolism (17)
- DNA replication (15)
- Non-homologous end-joining (15)
- Nucleotide excision repair (15)
- Dorso-ventral axis formation (14)
- Mismatch repair (14)
- Propanoate metabolism (14)
- Valine (14)
- Cysteine and methionine metabolism (13)
- Alanine (12)
- Butanoate metabolism (12)
- Fatty acid metabolism (12)
- aspartate and glutamate metabolism (12)
- Taste transduction (11)
- Tryptophan metabolism (11)
- Amino sugar and nucleotide sugar metabolism (10)
- Drug metabolism - other enzymes (10)
- Renin-angiotensin system (10)
- Glyoxylate and dicarboxylate metabolism (9)
- Graft-versus-host disease (9)
- Histidine metabolism (9)
- Linoleic acid metabolism (9)
- Lysine degradation (9)
- Nitrogen metabolism (9)
- Primary bile acid biosynthesis (9)
- beta-Alanine metabolism (9)
- leucine and isoleucine degradation (9)
- Allograft rejection (8)
- Fructose and mannose metabolism (8)
- Proteasome (8)
- Basal transcription factors (7)
- Biosynthesis of unsaturated fatty acids (7)
- Glycine (7)
- O-Glycan biosynthesis (7)
- Pentose phosphate pathway (7)
- Porphyrin and chlorophyll metabolism (7)
- serine and threonine metabolism (7)
- Aminoacyl-tRNA biosynthesis (6)
- Androgen and estrogen metabolism (6)
- Asthma (6)
- Folate biosynthesis (6)
- Selenoamino acid metabolism (6)
- ABC transporters (5)
- Autoimmune thyroid disease (5)
- C21-Steroid hormone metabolism (5)
- Circadian rhythm - mammal (5)
- Fatty acid biosynthesis (5)
- Heparan sulfate biosynthesis (5)
- N-Glycan biosynthesis (5)
- Sphingolipid metabolism (5)
- Terpenoid backbone biosynthesis (5)
- leucine and isoleucine biosynthesis (5)
- Ascorbate and aldarate metabolism (4)
- Chondroitin sulfate biosynthesis (4)
- D-Glutamine and D-glutamate metabolism (4)
- Galactose metabolism (4)
- Limonene and pinene degradation (4)
- RNA polymerase (4)
- Riboflavin metabolism (4)
- Starch and sucrose metabolism (4)
- Taurine and hypotaurine metabolism (4)
- Caffeine metabolism (3)
- Glycosaminoglycan degradation (3)
- Nicotinate and nicotinamide metabolism (3)
- SNARE interactions in vesicular transport (3)
- Ether lipid metabolism (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Keratan sulfate biosynthesis (2)
- One carbon pool by folate (2)
- Other glycan degradation (2)
- Pantothenate and CoA biosynthesis (2)
- Pentose and glucuronate interconversions (2)
- Synthesis and degradation of ketone bodies (2)
- alpha-Linolenic acid metabolism (2)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Methane metabolism (1)
- O-Mannosyl glycan biosynthesis (1)
- Phenylalanine metabolism (1)
- Protein export (1)
- Sulfur metabolism (1)
- Vitamin B6 metabolism (1)