Antibodies

View as table Download

Rabbit anti-IRF3 Polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IRF3

Rabbit Polyclonal FOXP3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3.

Rabbit Polyclonal antibody to ZKSCAN3 (zinc finger with KRAB and SCAN domains 3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 394 of ZKSCAN3 (Uniprot ID#Q9BRR0)

Rabbit Polyclonal Anti-SMURF2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2.

Rabbit polyclonal anti-HLX1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HLX1.

Rabbit Polyclonal Anti-NONO Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY

Rabbit Polyclonal Antibody against Nucleophosmin, mutant - AML Marker

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of human mutant nucleophosmin (exact sequence is within residues 250-298).

Rabbit Monoclonal antibody against Gli-1 (GLI1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal LSD1 Antibody

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSD1 antibody: human LSD1 (Lysine-specific demethylase 1), using a KLH-conjugated synthetic peptide from the inner part of the protein.

Rabbit anti-KDM1A Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KDM1A

Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70)

Rabbit Polyclonal PPARGC1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A.

USD 320.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.

Rabbit Polyclonal Anti-TRB3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRB3 antibody was raised against a 17 amino acid peptide near the center of human TRB3.

Rabbit Polyclonal Anti-SPIB Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB.

RBBP4 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RBBP4

Rabbit Polyclonal anti-p63 (?N) Antibody

Applications IF, WB
Reactivities Human (recognizes &Delta, N-isoforms)
Conjugation Unconjugated
Immunogen Modified peptide

Rabbit anti-ETS1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human ETS1

Rabbit Polyclonal Anti-OLIG2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen OLIG2 antibody was raised against a 15 amino acid peptide near the amino terminus of human OLIG2.

Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L).
Modifications Phospho-specific

Rabbit Polyclonal ZSCAN4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZSCAN4 antibody was raised against a 18 amino acid peptide near the carboxy terminus of human ZSCAN4.

Rabbit Polyclonal antibody to Rad54 (alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 2161 and 2443 of Rad54 (Uniprot ID#P46100)

Rabbit polyclonal anti-Cyclin E1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin E1.

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRIM21 antibody was raised against an 16 amino acid peptide near the center of human TRIM21.

Rabbit monoclonal antibody against c-Rel(clone EPR2558)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal HIF1A Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Hamster
Conjugation Unconjugated
Immunogen This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A.

Rabbit anti-TFAM Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TFAM

Rabbit Polyclonal Anti-CDX2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CDX2 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human CDX2.

Rabbit Polyclonal Anti-HMGB1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen HMGB1 antibody was raised against a 19 amino acid peptide near the center of human HMGB1.

Rabbit Polyclonal Anti-WAPL Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen WAPL antibody was raised against an 18 amino acid peptide near the amino terminus of human WAPL.

Rabbit Polyclonal Anti-SREBF2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SREBF2 antibody was raised against a 15 amino acid peptide near the center of human SREBF2.

Rabbit Polyclonal Anti-HDAC2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen HDAC2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human HDAC2.

Rabbit Polyclonal Anti-HDAC6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen HDAC6 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human HDAC6

Rabbit Polyclonal Anti-SNCA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SNCA antibody was raised against a 19 amino acid peptide near the carboxy terminus of human SNCA.

Rabbit Polyclonal Anti-E2F3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3.

Rabbit Polyclonal Anti-MALT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MALT1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human MALT1.

Rabbit Polyclonal Anti-TENM1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TENM1 antibody was raised against an 18 amino acid peptide near the amino terminus of human TENM1.

Rabbit Polyclonal VAMP7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VAMP7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human VAMP7.

Rabbit polyclonal ENOA Antibody (N-term)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA.

Rabbit Polyclonal Anti-PPP1R10 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R10 antibody: synthetic peptide directed towards the N terminal of human PPP1R10. Synthetic peptide located within the following region: SQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKP

Rabbit polyclonal MDM2 (Ab-166) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T).

Rabbit polyclonal GR (Ab-211) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W).

Rabbit polyclonal MITF (Ab-180/73) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M).

Rabbit Polyclonal ZEB2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZEB2 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human ZEB2.

Rabbit polyclonal LMO4 Antibody (Center)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This LMO4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 104-131 amino acids from the Central region of human LMO4.

Rabbit Polyclonal IRF7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7.

Rabbit monoclonal antibody against FOXO3a(clone EPR1950)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993)

Rabbit polyclonal KLF6 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This KLF6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 159-186 amino acids from the C-terminal region of human KLF6.

Rabbit anti-KEAP1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KEAP1