Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-HNRPA0 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal H3K9me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
Active filters
Applications
- IF
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Filter by
Target Symbol
- H3C1 (30)
- HISTONE H3 (18)
- AKT1 (14)
- BAX (11)
- STAT3 (11)
- RELA (10)
- MAP1LC3B (9)
- RB1 (9)
- SQSTM1 (9)
- BCL2 (8)
- IRF3 (8)
- IRS1 (8)
- MAPT (8)
- TARDBP (8)
- TP53 (8)
- APP (7)
- ATG7 (7)
- CASP3 (7)
- GAPDH (7)
- GJA1 (7)
- HISTONE H4 (7)
- KDM1A (7)
- RPS6KA1 (7)
- SMAD2 (7)
- ATG5 (6)
- CANX (6)
- CASP9 (6)
- CBX5 (6)
- EGFR (6)
- HIST1H3A (6)
- JUN (6)
- KLF4 (6)
- LAMP1 (6)
- NFKBIA (6)
- BRCA1 (5)
- CCNB1 (5)
- CHEK2 (5)
- COL1A2 (5)
- DFFB (5)
- EIF4E (5)
- ENO2 (5)
- FOXO1 (5)
- FOXO4 (5)
- GSK3B (5)
- HDAC2 (5)
- HDAC5 (5)
- HISTONE H2A (5)
- IKBKG (5)
- MAPK1 (5)
- MAPK14 (5)
- MCL1 (5)
- MEF2A (5)
- MTOR (5)
- NPM1 (5)
- PDIA3 (5)
- PECAM1 (5)
- PPARGC1A (5)
- PRKACA (5)
- PTEN (5)
- RHOA (5)
- RPS6KB1 (5)
- S PROTEIN (5)
- SMAD3 (5)
- SNCA (5)
- SUMO1 (5)
- TFAM (5)
- TNFAIP3 (5)
- ACE2 (4)
- ACHE (4)
- ACTB (4)
- AGR2 (4)
- AIPL1 (4)
- AKT2 (4)
- ALK (4)
- ANP32A (4)
- ARAF (4)
- ATG12 (4)
- ATG16L1 (4)
- AXIN2 (4)
- BCL2L11 (4)
- BIRC5 (4)
- CASP8 (4)
- CAV1 (4)
- CAV2 (4)
- CCNE1 (4)
- CD44 (4)
- CD63 (4)
- CDKN2A (4)
- CFLAR (4)
- CHI3L1 (4)
- CREB1 (4)
- CRMP1 (4)
- DDAH1 (4)
- DNM1L (4)
- E2F1 (4)
- EIF2AK3 (4)
- ENO1 (4)
- ESR1 (4)
- ETS1 (4)
- FASN (4)
Reactivities
- Human (6784)
- Mouse (5366)
- Rat (4402)
- Bovine (316)
- Pig (126)
- Monkey (123)
- Chicken (113)
- Rhesus Monkey (101)
- Xenopus (81)
- Zebrafish (68)
- X. tropicalis (58)
- Canine (55)
- Dog (55)
- Chimpanzee (43)
- Rabbit (30)
- Cow (20)
- Hamster (20)
- Primate (18)
- Feline (14)
- Sheep (14)
- Porcine (7)
- SARS-CoV-2 (7)
- Broad (5)
- Drosophila (5)
- Goat (4)
- Guinea Pig (4)
- Fusion proteins containing the Flag Tag (2)
- Mammalian (2)
- C. elegans (1)
- Fish (1)
- Horse (1)
- Medaka fish (1)
- Orang-Utan (1)
- Quail (1)
- SARS-CoV (1)
- SimianIVE (1)
- Staphylococcus aureus (1)
- Streptococcus Pyogenes (1)
- Yeast (1)
Antibody Hosts
Knockout (KO) Validation
Modifications
- Unmodified (2518)
- Phospho-specific (139)
- Acetyl K5 (3)
- Acetyl K12 (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K16 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K29 (1)
- Acetyl K36 (1)
- Acetyl K4 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S2056 (1)
- Phospho S241 (1)
- Phospho S2448 (1)
- Phospho S28 (1)
- Phospho S428 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S519/T522 (1)
- Phospho S70 (1)
- Phospho S9 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T180/Y182 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T389 (1)
- Phospho T395 (1)
- Phospho T45 (1)
- Phospho T498 (1)
- Phospho T6 (1)
- Phospho T91 (1)
- Phospho Y1022/1023 (1)
- Phospho Y15 (1)
- Phospho Y705 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
Assay Types
Families
- Druggable Genome (1995)
- Transmembrane (974)
- Transcription Factors (521)
- Protein Kinase (246)
- Secreted Protein (233)
- ES Cell Differentiation/IPS (174)
- GPCR (158)
- Stem cell - Pluripotency (156)
- Protease (93)
- Embryonic stem cells (40)
- Adult stem cells (35)
- Induced pluripotent stem cells (30)
- Nuclear Hormone Receptor (30)
- Phosphatase (26)
- Cancer stem cells (20)
- Ion Channels: Other (18)
- Stem cell relevant signaling - JAK/STAT signaling pathway (18)
- P450 (17)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (11)
- Ion Channels: Glutamate Receptors (9)
- Stem cell relevant signaling - DSL/Notch pathway (7)
- Ion Channels: Potassium (6)
- Ion Channels: Transient receptor potential (5)
- Stem cell relevant signaling - Wnt Signaling pathway (5)
- Ion Channels: Cyclic nucleotide gated (2)
- Ion Channels: Cys-loop Receptors (2)
- Ion Channels: ATP Receptors (1)
- Ion Channels: Calcium (1)
Pathways
- Pathways in cancer (238)
- Metabolic pathways (222)
- MAPK signaling pathway (121)
- Neuroactive ligand-receptor interaction (109)
- Focal adhesion (107)
- Neurotrophin signaling pathway (105)
- Cytokine-cytokine receptor interaction (102)
- Olfactory transduction (99)
- Apoptosis (98)
- Prostate cancer (88)
- Chemokine signaling pathway (87)
- Colorectal cancer (86)
- Insulin signaling pathway (85)
- Small cell lung cancer (85)
- Toll-like receptor signaling pathway (85)
- Cell cycle (84)
- Chronic myeloid leukemia (80)
- Regulation of actin cytoskeleton (78)
- Alzheimer's disease (73)
- Huntington's disease (71)
- RIG-I-like receptor signaling pathway (69)
- Pancreatic cancer (68)
- Endocytosis (66)
- T cell receptor signaling pathway (66)
- Wnt signaling pathway (64)
- Calcium signaling pathway (63)
- Adipocytokine signaling pathway (62)
- p53 signaling pathway (62)
- ErbB signaling pathway (57)
- Progesterone-mediated oocyte maturation (57)
- NOD-like receptor signaling pathway (56)
- Jak-STAT signaling pathway (55)
- Leukocyte transendothelial migration (54)
- Acute myeloid leukemia (53)
- Oocyte meiosis (53)
- Glioma (52)
- Melanoma (52)
- Non-small cell lung cancer (52)
- Systemic lupus erythematosus (52)
- B cell receptor signaling pathway (50)
- Ubiquitin mediated proteolysis (50)
- Endometrial cancer (49)
- Parkinson's disease (49)
- mTOR signaling pathway (48)
- Natural killer cell mediated cytotoxicity (46)
- Renal cell carcinoma (45)
- Gap junction (44)
- Adherens junction (42)
- Amyotrophic lateral sclerosis (ALS) (42)
- Axon guidance (42)
- Cytosolic DNA-sensing pathway (42)
- Epithelial cell signaling in Helicobacter pylori infection (41)
- Fc gamma R-mediated phagocytosis (41)
- Pathogenic Escherichia coli infection (39)
- Tight junction (39)
- VEGF signaling pathway (38)
- Melanogenesis (37)
- Bladder cancer (36)
- TGF-beta signaling pathway (34)
- Vascular smooth muscle contraction (33)
- Purine metabolism (32)
- ECM-receptor interaction (31)
- Regulation of autophagy (31)
- Glycolysis / Gluconeogenesis (30)
- Basal cell carcinoma (29)
- Fc epsilon RI signaling pathway (29)
- Notch signaling pathway (29)
- Viral myocarditis (29)
- Antigen processing and presentation (28)
- GnRH signaling pathway (27)
- Long-term potentiation (27)
- Cell adhesion molecules (CAMs) (26)
- Lysosome (26)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (25)
- Type II diabetes mellitus (25)
- Hematopoietic cell lineage (24)
- Oxidative phosphorylation (24)
- Spliceosome (24)
- Dilated cardiomyopathy (21)
- PPAR signaling pathway (21)
- Complement and coagulation cascades (20)
- Base excision repair (19)
- Hypertrophic cardiomyopathy (HCM) (19)
- Metabolism of xenobiotics by cytochrome P450 (19)
- Prion diseases (18)
- Thyroid cancer (18)
- Vibrio cholerae infection (18)
- Phosphatidylinositol signaling system (17)
- Primary immunodeficiency (17)
- Pyrimidine metabolism (17)
- Inositol phosphate metabolism (16)
- RNA degradation (16)
- Ribosome (16)
- Hedgehog signaling pathway (15)
- Long-term depression (15)
- Arginine and proline metabolism (14)
- DNA replication (14)
- Cardiac muscle contraction (13)
- Non-homologous end-joining (13)
- Citrate cycle (TCA cycle) (12)
- Drug metabolism - cytochrome P450 (12)
- Glycerolipid metabolism (12)
- Maturity onset diabetes of the young (12)
- Nucleotide excision repair (12)
- Pyruvate metabolism (12)
- Type I diabetes mellitus (12)
- Glutathione metabolism (11)
- Homologous recombination (11)
- Mismatch repair (10)
- Retinol metabolism (10)
- Taste transduction (10)
- Alanine (9)
- Arachidonic acid metabolism (9)
- Fatty acid metabolism (9)
- Tyrosine metabolism (9)
- Valine (9)
- aspartate and glutamate metabolism (9)
- Butanoate metabolism (8)
- Cysteine and methionine metabolism (8)
- Glycerophospholipid metabolism (8)
- Propanoate metabolism (8)
- Proteasome (8)
- Renin-angiotensin system (8)
- Dorso-ventral axis formation (7)
- Fructose and mannose metabolism (7)
- Histidine metabolism (7)
- O-Glycan biosynthesis (7)
- Allograft rejection (6)
- Amino sugar and nucleotide sugar metabolism (6)
- Drug metabolism - other enzymes (6)
- Glycine (6)
- Graft-versus-host disease (6)
- Pentose phosphate pathway (6)
- Primary bile acid biosynthesis (6)
- leucine and isoleucine degradation (6)
- serine and threonine metabolism (6)
- Autoimmune thyroid disease (5)
- Basal transcription factors (5)
- Biosynthesis of unsaturated fatty acids (5)
- Folate biosynthesis (5)
- Linoleic acid metabolism (5)
- N-Glycan biosynthesis (5)
- Selenoamino acid metabolism (5)
- Sphingolipid metabolism (5)
- Tryptophan metabolism (5)
- beta-Alanine metabolism (5)
- Aminoacyl-tRNA biosynthesis (4)
- Androgen and estrogen metabolism (4)
- Asthma (4)
- C21-Steroid hormone metabolism (4)
- Lysine degradation (4)
- Nitrogen metabolism (4)
- RNA polymerase (4)
- ABC transporters (3)
- Circadian rhythm - mammal (3)
- Fatty acid biosynthesis (3)
- Galactose metabolism (3)
- Glycosaminoglycan degradation (3)
- Heparan sulfate biosynthesis (3)
- Nicotinate and nicotinamide metabolism (3)
- SNARE interactions in vesicular transport (3)
- Taurine and hypotaurine metabolism (3)
- Terpenoid backbone biosynthesis (3)
- leucine and isoleucine biosynthesis (3)
- D-Glutamine and D-glutamate metabolism (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Keratan sulfate biosynthesis (2)
- Limonene and pinene degradation (2)
- One carbon pool by folate (2)
- Other glycan degradation (2)
- Pantothenate and CoA biosynthesis (2)
- Synthesis and degradation of ketone bodies (2)
- Ascorbate and aldarate metabolism (1)
- Caffeine metabolism (1)
- Chondroitin sulfate biosynthesis (1)
- Ether lipid metabolism (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Methane metabolism (1)
- Pentose and glucuronate interconversions (1)
- Phenylalanine metabolism (1)
- Porphyrin and chlorophyll metabolism (1)
- Riboflavin metabolism (1)
- Starch and sucrose metabolism (1)
- Sulfur metabolism (1)
- Vitamin B6 metabolism (1)