Antibodies

Jump to Filters

Download

1 - 50 of 1097 results

Page 1 of 22

(reset)

LIPG Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9C5]

TA500998AM

USD 420.00

In Stock

LIPG mouse monoclonal antibody, clone 9C5, Biotinylated

Applications	IF, IHC, IP, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Monoamine Oxidase A (MAOA) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

TA504266

USD 379.00

In Stock

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

DNMT1 Rabbit Monoclonal Antibody [Clone ID: EPR3521(2)]

TA307586

USD 516.00

In Stock

Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

Monoamine Oxidase A (MAOA) Mouse Monoclonal Antibody [Clone ID: OTI1D6]

TA504265

USD 379.00

In Stock

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD13 (ANPEP) Rabbit Monoclonal Antibody [Clone ID: EPR4058]

TA307568

USD 520.00

In Stock

Rabbit monoclonal antibody against CD13(clone EPR4058)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

NME5 Rabbit Polyclonal Antibody

TA349418

USD 380.00

In Stock

Rabbit Polyclonal Anti-NME5 Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human NME5

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

iNOS (NOS2) Rabbit Polyclonal Antibody

TA349419

USD 380.00

In Stock

Rabbit Polyclonal Anti-NOS2 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human NOS2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GAD65 (GAD2) Rabbit Polyclonal Antibody

TA308367

USD 415.00

In Stock

Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

AGL Rabbit Monoclonal Antibody [Clone ID: EPR8880]

TA310177

USD 432.00

In Stock

Rabbit Monoclonal antibody against AGL

Applications	Assay, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

AMACR Rabbit Polyclonal Antibody

TA349234

USD 380.00

In Stock

Rabbit Polyclonal Anti-AMACR Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human AMACR

1 / 3

2 / 3

3 / 3

Previous Next

Aromatase (CYP19A1) Rabbit Polyclonal Antibody

TA311724

USD 345.00

In Stock

Rabbit polyclonal Cytochrome P450 19A1 antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 19A1.

1 / 3

2 / 3

3 / 3

Previous Next

Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody

TA326897

USD 374.00

In Stock

Rabbit anti-ENO1 Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ENO1

1 / 2

2 / 2

Previous Next

GALNS Rabbit Polyclonal Antibody

TA308487

USD 415.00

In Stock

Rabbit Polyclonal antibody to GALNS (galactosamine (N-acetyl)-6-sulfate sulfatase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant protein fragment contain a sequence corresponding to a region within amino acids 20 and 259 of GALNS

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Arginase 1 (ARG1) Rabbit Polyclonal Antibody

TA308162

USD 415.00

In Stock

Rabbit Polyclonal antibody to Arginase I (arginase, liver)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LDHA Rabbit Monoclonal Antibody [Clone ID: EP1563Y]

TA300879

USD 509.00

In Stock

Rabbit Monoclonal Antibody against LDHA (Clone EP1563Y)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

PHPT1 Rabbit Polyclonal Antibody

TA302276

USD 450.00

In Stock

Rabbit Polyclonal Antibody against PHPT1 (C-term)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 88-117 amino acids from the C-terminal region of human PHPT1.

1 / 2

2 / 2

Previous Next

GLB1 Rabbit Polyclonal Antibody

TA308238

USD 415.00

In Stock

Rabbit polyclonal antibody to beta-Gal (galactosidase, beta 1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 166 and 677 of beta-Gal (Uniprot ID#P16278)

1 / 2

2 / 2

Previous Next

GBA Rabbit Polyclonal Antibody

TA308240

USD 415.00

In Stock

Rabbit Polyclonal antibody to GBA (glucosidase, beta, acid)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 352 and 536 of GBA (Uniprot ID#P04062)

1 / 3

2 / 3

3 / 3

Previous Next

GAD67 (GAD1) Rabbit Polyclonal Antibody

TA311806

USD 345.00

In Stock

Rabbit polyclonal anti-GAD67/GAD1 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human GAD67.
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

MTR Goat Polyclonal Antibody

TA302710

USD 375.00

In Stock

Goat Polyclonal Antibody against MTR

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245.

1 / 2

2 / 2

Previous Next

Fatty Acid Synthase (FASN) Rabbit Polyclonal Antibody

TA308750

USD 415.00

In Stock

Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)

Applications	IF, IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327)

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

HPRT (HPRT1) Rabbit Polyclonal Antibody

TA308902

USD 415.00

In Stock

Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 23 and 218 of HPRT (Uniprot ID#P00492)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LIPC Rabbit Polyclonal Antibody

TA327045

USD 380.00

In Stock

Rabbit anti-LIPC Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant protein of human LIPC

Peroxiredoxin 6 (PRDX6) Rabbit Monoclonal Antibody [Clone ID: EPR3755]

TA307267

USD 509.00

In Stock

Rabbit monoclonal antibody against Peroxiredoxin 6 (clone EPR3755 )

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ASS1 Rabbit Polyclonal Antibody

TA308171

USD 415.00

In Stock

Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 198 of ASS1 (Uniprot ID#P00966)

1 / 2

2 / 2

Previous Next

HPRT (HPRT1) Rabbit Polyclonal Antibody

TA308901

USD 415.00

In Stock

Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 218 of HPRT (Uniprot ID#P00492)

1 / 3

2 / 3

3 / 3

Previous Next

GLCNE (GNE) Rabbit Polyclonal Antibody

TA315006

USD 345.00

In Stock

Rabbit polyclonal anti-GNE antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human GNE.

1 / 2

2 / 2

Previous Next

Fatty Acid Synthase (FASN) Rabbit Polyclonal Antibody

TA324935

USD 450.00

In Stock

Rabbit polyclonal FASN Antibody (Center)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This FASN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 942-973 amino acids from the Central region of human FASN.

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Alanine Transaminase (GPT) Rabbit Polyclonal Antibody

TA338150

USD 310.00

In Stock

Rabbit Polyclonal Anti-GPT Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT

1 / 2

2 / 2

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody

TA590756

USD 409.00

In Stock

Rabbit Polyclonal FALDH Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

CBR1 Goat Polyclonal Antibody

TA302807

USD 375.00

In Stock

Goat Polyclonal Antibody against CBR1

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-HGQFVSEKRVEQW, from the C Terminus of the protein sequence according to NP_001748.1.

1 / 2

2 / 2

Previous Next

FDPS Rabbit Monoclonal Antibody [Clone ID: EPR4628]

TA307581

USD 509.00

In Stock

Rabbit monoclonal antibody against FDPS(clone EPR4628)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

PANK1 Rabbit Polyclonal Antibody

TA308055

USD 415.00

In Stock

Rabbit Polyclonal antibody to PANK1 (pantothenate kinase 1)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 207 and 513 of PANK1 (Uniprot ID#Q8TE04)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

DHFR Rabbit Monoclonal Antibody [Clone ID: EPR5285]

TA310408

USD 512.00

In Stock

Rabbit Monoclonal antibody against DHFR

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

ALDOB Rabbit Polyclonal Antibody

TA590002

USD 409.00

In Stock

Rabbit Polyclonal Aldolase B Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

FH Rabbit Polyclonal Antibody

TA590010

USD 409.00

In Stock

Rabbit Polyclonal Fumarase Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the Middle Region of the target protein.

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

PON1 Rabbit Polyclonal Antibody

TA590020

USD 409.00

In Stock

Rabbit Polyclonal PON1 Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human, Rat, Dog
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

BDH2 Goat Polyclonal Antibody

TA302431

USD 375.00

In Stock

Goat Polyclonal Antibody against BDH2 / DHRS6 (aa 60 to 71)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-TKKKQIDQFANE, from the internal region of the protein sequence according to NP_064524.3.

1 / 3

2 / 3

3 / 3

Previous Next

PRPS2 Rabbit Polyclonal Antibody

TA308129

USD 415.00

In Stock

Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908)

1 / 3

2 / 3

3 / 3

Previous Next

UGT (UGT1A9) Rabbit Polyclonal Antibody

TA308133

USD 415.00

In Stock

Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656)

1 / 3

2 / 3

3 / 3

Previous Next

GBA Rabbit Polyclonal Antibody

TA308241

USD 415.00

In Stock

Rabbit polyclonal antibody to beta-glucosidase (glucosidase, beta; acid (includes glucosylceramidase))

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 65 and 384 of GBA (Uniprot ID#P04062)

1 / 2

2 / 2

Previous Next

CPS1 Rabbit Monoclonal Antibody [Clone ID: EPR7493]

TA310349

USD 509.00

In Stock

Rabbit Monoclonal antibody against CPS1

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

Creatine kinase M type (CKM) Rabbit Polyclonal Antibody

TA313625

USD 345.00

In Stock

Rabbit polyclonal anti-CKM / M-CK antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from N-terminal of human M-CK.

1 / 3

2 / 3

3 / 3

Previous Next

CHPF Rabbit Polyclonal Antibody

TA315791

USD 345.00

In Stock

Rabbit polyclonal anti-CHPH (CHSS2) antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human CHSS2.

1 / 3

2 / 3

3 / 3

Previous Next

GLUD1 Goat Polyclonal Antibody

TA316789

USD 425.00

In Stock

GLUD1 Goat Polyclonal (Internal) Antibody

Applications	IHC
Reactivities	Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig
Conjugation	Unconjugated
Immunogen	GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%).

NM23A (NME1) Rabbit Polyclonal Antibody

TA590015

USD 409.00

In Stock

Rabbit Polyclonal nm23-H1 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the Middle Region of the target protein.

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Adenylate Kinase 1 (AK1) Rabbit Polyclonal Antibody

TA590022

USD 409.00

In Stock

Rabbit Polyclonal Adenylate Kinase 1 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ALDH4A1 Rabbit Polyclonal Antibody

TA590378

USD 409.00

In Stock

Rabbit Polyclonal ALDH4A1 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

1 / 3

2 / 3

3 / 3

Previous Next

PCK1 Rabbit Polyclonal Antibody

TA590679

USD 409.00

In Stock

Rabbit Polyclonal PCK1 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the Middle Region of the target protein.

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ALDH2 Rabbit Polyclonal Antibody

TA302016

USD 450.00

In Stock

Rabbit Polyclonal Antibody against ALDH2 (Center)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2.

1 / 2

2 / 2

Previous Next

1 - 50 of 1097 results

Page 1 of 22