Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-Rabbit IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Rabbit IgG |
| Conjugation | Unconjugated |
| Immunogen | Rabbit IgG, whole molecule |
Ki67 (MKI67) (C-term) rabbit monoclonal antibody, clone SP6, Supernatant
| Applications | IHC |
| Reactivities | Human, Mouse |
Goat Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Biotin Conjugated Goat Anti-Rabbit IgG
| Applications | WB: 1:200-400; ICC: 1:100-200; IHC: 1:100-200; ELISA: 1:5,000-20,000 |
| Reactivities | Rabbit IgG |
| Conjugation | Biotin |
| Immunogen | Rabbit IgG, whole molecule |
Vsx2 (N-term) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Immunogen | A recombinant protein corresponding to amino acids 1 to 131 derived from the N-terminal of the Human Chx10 protein conjugated to GST. |
Rabbit Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Sheep |
| Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
Pdpn hamster monoclonal antibody, clone 811, Purified
| Applications | IHC, IP, WB |
| Reactivities | Mouse |
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Tcl1 (TCL1A) mouse monoclonal antibody, clone MRQ-7, Supernatant
| Applications | IHC |
| Reactivities | Human |
GFP (Ads. to Hu, Ms, Rt Serum Proteins) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | A. victoria |
| Immunogen | Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Laminin 5 (LAMB3) mouse monoclonal antibody, clone 6F12, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Rat |
Vsx2 (C-term) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Immunogen | A recombinant protein corresponding to amino acids 264 to 361 derived from the C terminal of the Human Chx10 protein conjugated to KLH. |
Iba1 (149-161) goat polyclonal antibody, Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide.
| Applications | ELISA, IHC, WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Porcine, Rat, Bovine, Equine, Goat, Rabbit, Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TGPPAKKAISELP, from the C-Terminus of protein sequence according to NP_116573.1NP_001614.3. |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Laminin 5 (LAMB3) mouse monoclonal antibody, clone 6F12, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Rat |
Biotin Conjugated Goat Anti-Mouse IgG
| Applications | WB: 1:200-400; ICC: 1:100-200; IHC: 1:100-200; ELISA: 1:5,000-20,000 |
| Reactivities | Mouse IgG |
| Conjugation | Biotin |
| Immunogen | Mouse IgG, whole molecule |
Rabbit Anti-Goat IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Goat IgG |
| Conjugation | Unconjugated |
| Immunogen | Goat IgG, whole molecule |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit polyclonal HAPLN1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HAPLN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-38 amino acids from the N-terminal region of human HAPLN1. |
Active filters
Category
Applications
- IHC
Isotypes
- IgG
Citations
- Yes
Filter by
Target Symbol
- BAX (3)
- CD274 (3)
- ABCC4 (2)
- AOX1 (2)
- BAG3 (2)
- CCR6 (2)
- COL1A1 (2)
- CTSD (2)
- GAD1 (2)
- GAPDH (2)
- HIF1A (2)
- MAP1LC3B (2)
- MITF (2)
- PTEN (2)
- RAB27A (2)
- RELA (2)
- ROR2 (2)
- SERPINA3 (2)
- TFAM (2)
- VEGFA (2)
- VSX2 (2)
- ABCC5 (1)
- ABCG2 (1)
- ACSL3 (1)
- ACSL4 (1)
- ACTG2 (1)
- ADAM10 (1)
- ADAMDEC1 (1)
- ADAMTS1 (1)
- ADAMTS16 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- ADH5 (1)
- AGL (1)
- AHSP (1)
- AKAP12 (1)
- AKT1 (1)
- ALPG (1)
- ANGPT2 (1)
- ANGPTL8 (1)
- ANPEP (1)
- ANTXR1 (1)
- AP1M1 (1)
- APAF1 (1)
- APOBEC3B (1)
- AQP4 (1)
- ARAP1 (1)
- ASAH1 (1)
- ATG5 (1)
- ATRX (1)
- ATXN1 (1)
- B3GLCT (1)
- BABAM2 (1)
- BCL2L10 (1)
- BCL6 (1)
- BID (1)
- BRCA1 (1)
- BRCA2 (1)
- BST2 (1)
- BTG3 (1)
- CALB1 (1)
- CALCRL (1)
- CALN1 (1)
- CAMK1D (1)
- CASP3 (1)
- CASP9 (1)
- CASQ1 (1)
- CAV1 (1)
- CBS (1)
- CCND2 (1)
- CCNE1 (1)
- CD276 (1)
- CD46 (1)
- CD81 (1)
- CDH5 (1)
- CDK6 (1)
- CDKN2A (1)
- CDKN2B (1)
- CEBPA (1)
- CENPE (1)
- CHGA (1)
- CHRNA4 (1)
- CHSY1 (1)
- CLDN11 (1)
- COL2A1 (1)
- CP (1)
- CRY1 (1)
- CS (1)
- CSTB (1)
- CTNNB1 (1)
- CUL7 (1)
- CX3CR1 (1)
- CYP19A1 (1)
- CYP24A1 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- CYP8B1 (1)
- DACT2 (1)
- DAPK1 (1)
- DBH (1)
Reactivities
- Human (332)
- Mouse (247)
- Rat (201)
- Bovine (17)
- Monkey (13)
- Pig (12)
- Dog (10)
- Xenopus (7)
- Gorilla (6)
- Rhesus Monkey (6)
- Canine (5)
- Rabbit (5)
- Chimpanzee (4)
- Zebrafish (4)
- Chicken (3)
- Cow (3)
- Hamster (3)
- Horse (3)
- X. tropicalis (3)
- Bat (2)
- Drosophila (1)
- Feline (1)
- Gibbon (1)
- Murine (1)
- Orang-Utan (1)
- Porcine (1)
- Primate (1)
- Sheep (1)
- Tadpole (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (241)
- Transmembrane (117)
- Transcription Factors (45)
- Secreted Protein (42)
- ES Cell Differentiation/IPS (36)
- Protein Kinase (23)
- Protease (16)
- GPCR (12)
- Stem cell - Pluripotency (9)
- Adult stem cells (8)
- Cancer stem cells (7)
- Ion Channels: Other (4)
- P450 (4)
- Phosphatase (4)
- Stem cell relevant signaling - DSL/Notch pathway (4)
- Embryonic stem cells (3)
- Ion Channels: Transient receptor potential (3)
- Induced pluripotent stem cells (2)
- Ion Channels: Cys-loop Receptors (2)
- Nuclear Hormone Receptor (2)
- Stem cell relevant signaling - JAK/STAT signaling pathway (2)
- Stem cell relevant signaling - Wnt Signaling pathway (1)
Pathways
- Pathways in cancer (48)
- Metabolic pathways (37)
- Focal adhesion (27)
- Small cell lung cancer (17)
- Huntington's disease (16)
- Prostate cancer (16)
- p53 signaling pathway (16)
- Cytokine-cytokine receptor interaction (15)
- Pancreatic cancer (15)
- Chemokine signaling pathway (14)
- ECM-receptor interaction (14)
- MAPK signaling pathway (14)
- Adipocytokine signaling pathway (13)
- Apoptosis (13)
- Toll-like receptor signaling pathway (13)
- Alzheimer's disease (12)
- Colorectal cancer (12)
- Regulation of actin cytoskeleton (12)
- Melanoma (11)
- Cell adhesion molecules (CAMs) (10)
- Neurotrophin signaling pathway (10)
- RIG-I-like receptor signaling pathway (10)
- Glioma (9)
- Leukocyte transendothelial migration (9)
- Adherens junction (8)
- Amyotrophic lateral sclerosis (ALS) (8)
- Calcium signaling pathway (8)
- Cytosolic DNA-sensing pathway (8)
- Endocytosis (8)
- Epithelial cell signaling in Helicobacter pylori infection (8)
- Jak-STAT signaling pathway (8)
- Neuroactive ligand-receptor interaction (8)
- Parkinson's disease (8)
- Renal cell carcinoma (8)
- Tight junction (8)
- Acute myeloid leukemia (7)
- Chronic myeloid leukemia (7)
- Endometrial cancer (7)
- Gap junction (7)
- Insulin signaling pathway (7)
- Lysosome (7)
- NOD-like receptor signaling pathway (7)
- Natural killer cell mediated cytotoxicity (7)
- B cell receptor signaling pathway (6)
- Bladder cancer (6)
- Cell cycle (6)
- Dilated cardiomyopathy (6)
- ErbB signaling pathway (6)
- Hematopoietic cell lineage (6)
- Non-small cell lung cancer (6)
- Prion diseases (6)
- T cell receptor signaling pathway (6)
- Viral myocarditis (6)
- Complement and coagulation cascades (5)
- Hypertrophic cardiomyopathy (HCM) (5)
- Melanogenesis (5)
- Progesterone-mediated oocyte maturation (5)
- Type I diabetes mellitus (5)
- VEGF signaling pathway (5)
- mTOR signaling pathway (5)
- ABC transporters (4)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (4)
- Axon guidance (4)
- Citrate cycle (TCA cycle) (4)
- Drug metabolism - cytochrome P450 (4)
- Glycolysis / Gluconeogenesis (4)
- GnRH signaling pathway (4)
- Oocyte meiosis (4)
- Oxidative phosphorylation (4)
- PPAR signaling pathway (4)
- Tyrosine metabolism (4)
- Vascular smooth muscle contraction (4)
- Wnt signaling pathway (4)
- Alanine (3)
- Antigen processing and presentation (3)
- Basal cell carcinoma (3)
- Butanoate metabolism (3)
- Cardiac muscle contraction (3)
- Fatty acid metabolism (3)
- Fc epsilon RI signaling pathway (3)
- Fc gamma R-mediated phagocytosis (3)
- Porphyrin and chlorophyll metabolism (3)
- TGF-beta signaling pathway (3)
- Taurine and hypotaurine metabolism (3)
- Type II diabetes mellitus (3)
- Valine (3)
- aspartate and glutamate metabolism (3)
- beta-Alanine metabolism (3)
- leucine and isoleucine degradation (3)
- Allograft rejection (2)
- Autoimmune thyroid disease (2)
- Cysteine and methionine metabolism (2)
- Dorso-ventral axis formation (2)
- Folate biosynthesis (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Graft-versus-host disease (2)
- Hedgehog signaling pathway (2)
- Homologous recombination (2)
- Inositol phosphate metabolism (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Mismatch repair (2)
- N-Glycan biosynthesis (2)
- Nicotinate and nicotinamide metabolism (2)
- Notch signaling pathway (2)
- Pathogenic Escherichia coli infection (2)
- Phosphatidylinositol signaling system (2)
- Primary bile acid biosynthesis (2)
- Purine metabolism (2)
- Regulation of autophagy (2)
- Renin-angiotensin system (2)
- Retinol metabolism (2)
- SNARE interactions in vesicular transport (2)
- Sphingolipid metabolism (2)
- Starch and sucrose metabolism (2)
- Tryptophan metabolism (2)
- Ubiquitin mediated proteolysis (2)
- Vitamin B6 metabolism (2)
- Androgen and estrogen metabolism (1)
- Base excision repair (1)
- Biosynthesis of unsaturated fatty acids (1)
- Chondroitin sulfate biosynthesis (1)
- Circadian rhythm - mammal (1)
- DNA replication (1)
- Drug metabolism - other enzymes (1)
- Fructose and mannose metabolism (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycine (1)
- Glycosaminoglycan degradation (1)
- Linoleic acid metabolism (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Methane metabolism (1)
- Nucleotide excision repair (1)
- O-Glycan biosynthesis (1)
- Other glycan degradation (1)
- Propanoate metabolism (1)
- Proteasome (1)
- Pyruvate metabolism (1)
- Selenoamino acid metabolism (1)
- Spliceosome (1)
- Thyroid cancer (1)
- Vibrio cholerae infection (1)
- serine and threonine metabolism (1)