Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
CD4 mouse monoclonal antibody, clone B-A1, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Antibody against NANOG (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-49 amino acids from the N-terminal region of human NANOG. |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit polyclonal KLF5 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5. |
Rabbit Polyclonal Anti-SOX7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the middle region of human SOX7. Synthetic peptide located within the following region: LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLIS |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit polyclonal SOX4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 86-114 amino acids from the N-terminal region of human SOX4. |
Rabbit Polyclonal Anti-OTX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
| Applications | IF, IHC, IP, WB |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Human |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit Polyclonal Anti-SOX4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX4 Antibody: synthetic peptide directed towards the N terminal of human SOX4. Synthetic peptide located within the following region: MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPS |
CD38 mouse monoclonal antibody, clone T16, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal Antibody against NANOG (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 94-123 amino acids from the Central region of human NANOG. |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal AXIN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AXIN2 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human AXIN2. The immunogen is located within amino acids 780 - 830 of AXIN2. |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
c-Myc (MYC) mouse monoclonal antibody, clone IMD-3, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Families
- Induced pluripotent stem cells
Filter by
Target Symbol
- CD4 (85)
- MYC (32)
- EGF (16)
- SOX9 (15)
- CD38 (13)
- PDX1 (13)
- KLF5 (12)
- OTX2 (11)
- FOXA2 (10)
- POU5F1 (10)
- BDNF (9)
- SOX2 (9)
- GATA4 (7)
- BMP4 (6)
- TCF3 (6)
- WNT3A (6)
- KLF4 (5)
- NANOG (5)
- SOX4 (5)
- FGF4 (4)
- AXIN2 (3)
- BMP2 (3)
- BMP7 (3)
- SOX10 (3)
- WNT8A (3)
- BMP5 (2)
- BMP6 (2)
- DNMT3B (2)
- DPPA2 (2)
- GDF3 (2)
- SOX11 (2)
- BMP8B (1)
- NODAL (1)
- PDGFC (1)
- SOX7 (1)
- UTF1 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Hematopoietic cell lineage (101)
- Antigen processing and presentation (85)
- Cell adhesion molecules (CAMs) (85)
- Primary immunodeficiency (85)
- T cell receptor signaling pathway (85)
- Pathways in cancer (73)
- MAPK signaling pathway (61)
- Endometrial cancer (51)
- TGF-beta signaling pathway (50)
- Bladder cancer (48)
- ErbB signaling pathway (48)
- Wnt signaling pathway (44)
- Acute myeloid leukemia (35)
- Colorectal cancer (35)
- Cell cycle (32)
- Chronic myeloid leukemia (32)
- Jak-STAT signaling pathway (32)
- Small cell lung cancer (32)
- Thyroid cancer (32)
- Hedgehog signaling pathway (26)
- Cytokine-cytokine receptor interaction (23)
- Maturity onset diabetes of the young (23)
- Basal cell carcinoma (21)
- Melanoma (21)
- Regulation of actin cytoskeleton (21)
- Endocytosis (19)
- Focal adhesion (17)
- Gap junction (17)
- Prostate cancer (17)
- Glioma (16)
- Non-small cell lung cancer (16)
- Pancreatic cancer (16)
- Metabolic pathways (15)
- Calcium signaling pathway (13)
- Nicotinate and nicotinamide metabolism (13)
- Type II diabetes mellitus (13)
- Melanogenesis (12)
- Huntington's disease (9)
- Neurotrophin signaling pathway (9)
- Cysteine and methionine metabolism (2)