Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
Rabbit Polyclonal Anti-INSIG1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INSIG1 antibody: synthetic peptide directed towards the middle region of human INSIG1. Synthetic peptide located within the following region: ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Calneuron-1 / CALN1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Calneuron-1 / CALN1 antibody was raised against a 16 amino acid peptide near the amino terminus of human CaBP8. |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
GRIA3 Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRIA3 |
Active filters
Category
- Antibodies
Reactivities
- Rat
Applications
- IHC
Isotypes
- IgG
Families
- Transmembrane
Filter by
Target Symbol
- BAX (9)
- APP (6)
- KDR (6)
- DIABLO (5)
- FGFR3 (5)
- ADRA1B (4)
- AIFM1 (4)
- BCL2L1 (4)
- BDNF (4)
- CDH1 (4)
- CLDN1 (4)
- CLDN5 (4)
- CLDN7 (4)
- EIF2AK3 (4)
- ERBB3 (4)
- GJB6 (4)
- GRIA2 (4)
- GRIK1 (4)
- GRIN1 (4)
- HCRTR1 (4)
- MERTK (4)
- MME (4)
- NPHS1 (4)
- NTRK1 (4)
- NTRK2 (4)
- RTN4 (4)
- SCN11A (4)
- SLC2A1 (4)
- SPAG4 (4)
- TRPC3 (4)
- TRPV4 (4)
- ACE2 (3)
- ACVR1C (3)
- ADAM15 (3)
- ADGRA2 (3)
- AGTR2 (3)
- ANPEP (3)
- AQP2 (3)
- AQP3 (3)
- BSG (3)
- CADM3 (3)
- CADM4 (3)
- CCR3 (3)
- CD151 (3)
- CFTR (3)
- CLDN10 (3)
- CLDN4 (3)
- CMTM6 (3)
- CNGA2 (3)
- CPT1A (3)
- CYP2E1 (3)
- CYP3A4 (3)
- EDA (3)
- ERBB2 (3)
- FAIM2 (3)
- FGFR2 (3)
- FZD8 (3)
- GLG1 (3)
- GRIA3 (3)
- GRM1 (3)
- GRM3 (3)
- GRM4 (3)
- GRPR (3)
- IGF1R (3)
- IL1R1 (3)
- IL23R (3)
- KCNJ6 (3)
- LPAR4 (3)
- LRP5 (3)
- MAVS (3)
- MC4R (3)
- MMP14 (3)
- NCSTN (3)
- NOX3 (3)
- PTPRM (3)
- SCN5A (3)
- SLC1A4 (3)
- SLC1A7 (3)
- SLC8A3 (3)
- STEAP4 (3)
- TAP2 (3)
- TENM3 (3)
- TGFBR1 (3)
- TLR5 (3)
- TLR8 (3)
- TRPC6 (3)
- TRPM7 (3)
- TSPAN13 (3)
- VTCN1 (3)
- WNT10A (3)
- A4GNT (2)
- AADAC (2)
- ABCB11 (2)
- ABCB5 (2)
- ABCB6 (2)
- ABCB9 (2)
- ABCC1 (2)
- ABCC4 (2)
- ABCC5 (2)
- ABCG1 (2)
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (187)
- Cytokine-cytokine receptor interaction (117)
- Pathways in cancer (107)
- Calcium signaling pathway (96)
- Metabolic pathways (83)
- Cell adhesion molecules (CAMs) (77)
- MAPK signaling pathway (56)
- Endocytosis (55)
- Alzheimer's disease (53)
- Colorectal cancer (46)
- Leukocyte transendothelial migration (43)
- Melanogenesis (42)
- Regulation of actin cytoskeleton (42)
- Amyotrophic lateral sclerosis (ALS) (38)
- Hematopoietic cell lineage (37)
- Focal adhesion (36)
- Jak-STAT signaling pathway (36)
- ABC transporters (34)
- Wnt signaling pathway (34)
- Apoptosis (32)
- Gap junction (32)
- Adherens junction (30)
- Vascular smooth muscle contraction (30)
- Neurotrophin signaling pathway (29)
- Basal cell carcinoma (28)
- Huntington's disease (28)
- Dilated cardiomyopathy (27)
- Axon guidance (26)
- Tight junction (26)
- Pancreatic cancer (25)
- Chemokine signaling pathway (24)
- Long-term potentiation (24)
- TGF-beta signaling pathway (22)
- Prostate cancer (21)
- Adipocytokine signaling pathway (20)
- GnRH signaling pathway (19)
- Melanoma (19)
- Purine metabolism (19)
- Toll-like receptor signaling pathway (19)
- Hedgehog signaling pathway (17)
- Hypertrophic cardiomyopathy (HCM) (17)
- Renin-angiotensin system (17)
- Bladder cancer (16)
- Chronic myeloid leukemia (16)
- ECM-receptor interaction (16)
- ErbB signaling pathway (16)
- Long-term depression (16)
- p53 signaling pathway (15)
- Natural killer cell mediated cytotoxicity (14)
- Notch signaling pathway (14)
- Oocyte meiosis (14)
- Pathogenic Escherichia coli infection (14)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (13)
- Progesterone-mediated oocyte maturation (13)
- Renal cell carcinoma (13)
- Parkinson's disease (12)
- Prion diseases (12)
- Cardiac muscle contraction (11)
- Drug metabolism - cytochrome P450 (11)
- Endometrial cancer (11)
- Glioma (11)
- Lysosome (11)
- Metabolism of xenobiotics by cytochrome P450 (10)
- Retinol metabolism (10)
- SNARE interactions in vesicular transport (10)
- Taste transduction (10)
- Arachidonic acid metabolism (9)
- Epithelial cell signaling in Helicobacter pylori infection (9)
- N-Glycan biosynthesis (9)
- Non-small cell lung cancer (9)
- Small cell lung cancer (9)
- T cell receptor signaling pathway (9)
- Thyroid cancer (9)
- Type II diabetes mellitus (9)
- Complement and coagulation cascades (8)
- Oxidative phosphorylation (8)
- PPAR signaling pathway (8)
- Primary immunodeficiency (8)
- Vibrio cholerae infection (8)
- Antigen processing and presentation (7)
- Linoleic acid metabolism (7)
- Pyrimidine metabolism (7)
- Tyrosine metabolism (7)
- Glutathione metabolism (6)
- Glycerolipid metabolism (6)
- Nicotinate and nicotinamide metabolism (6)
- Systemic lupus erythematosus (6)
- VEGF signaling pathway (6)
- Viral myocarditis (6)
- Androgen and estrogen metabolism (5)
- Autoimmune thyroid disease (5)
- Cytosolic DNA-sensing pathway (5)
- Drug metabolism - other enzymes (5)
- Glycerophospholipid metabolism (5)
- Porphyrin and chlorophyll metabolism (5)
- RIG-I-like receptor signaling pathway (5)
- Sphingolipid metabolism (5)
- Type I diabetes mellitus (5)
- Allograft rejection (4)
- Cell cycle (4)
- Dorso-ventral axis formation (4)
- Ether lipid metabolism (4)
- Fatty acid metabolism (4)
- Fc gamma R-mediated phagocytosis (4)
- Glycosphingolipid biosynthesis - lacto and neolacto series (4)
- Graft-versus-host disease (4)
- O-Glycan biosynthesis (4)
- Riboflavin metabolism (4)
- Starch and sucrose metabolism (4)
- Tryptophan metabolism (4)
- Asthma (3)
- B cell receptor signaling pathway (3)
- Biosynthesis of unsaturated fatty acids (3)
- Chondroitin sulfate biosynthesis (3)
- Glycosphingolipid biosynthesis - globo series (3)
- Heparan sulfate biosynthesis (3)
- Inositol phosphate metabolism (3)
- Keratan sulfate biosynthesis (3)
- Olfactory transduction (3)
- Ascorbate and aldarate metabolism (2)
- C21-Steroid hormone metabolism (2)
- Cyanoamino acid metabolism (2)
- Fc epsilon RI signaling pathway (2)
- Glycine (2)
- Glycosphingolipid biosynthesis - ganglio series (2)
- Insulin signaling pathway (2)
- NOD-like receptor signaling pathway (2)
- Nitrogen metabolism (2)
- Pantothenate and CoA biosynthesis (2)
- Pentose and glucuronate interconversions (2)
- Phenylalanine metabolism (2)
- Phosphatidylinositol signaling system (2)
- Propanoate metabolism (2)
- Selenoamino acid metabolism (2)
- Steroid biosynthesis (2)
- Taurine and hypotaurine metabolism (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- serine and threonine metabolism (2)
- Acute myeloid leukemia (1)
- Arginine and proline metabolism (1)
- Caffeine metabolism (1)
- Glycosaminoglycan degradation (1)
- Histidine metabolism (1)
- Primary bile acid biosynthesis (1)
- Terpenoid backbone biosynthesis (1)
- Ubiquitin mediated proteolysis (1)
- beta-Alanine metabolism (1)