Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit Polyclonal Anti-STK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-ARRB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Active filters
Category
- Antibodies
Applications
- IHC
Isotypes
- IgG
Pathways
- MAPK signaling pathway
Filter by
Target Symbol
- AKT1 (22)
- RELA (13)
- TP53 (13)
- CASP3 (12)
- ATF2 (10)
- JUN (10)
- BRAF (8)
- EGFR (8)
- PAK1 (8)
- BDNF (7)
- JUND (7)
- STMN1 (7)
- CHUK (6)
- FGFR2 (6)
- FGFR3 (6)
- FOS (6)
- HSPA1A (6)
- MAP2K6 (6)
- MAPK14 (6)
- PRKCA (6)
- TNF (6)
- ARRB1 (5)
- ELK1 (5)
- FASLG (5)
- HSPB1 (5)
- IKBKG (5)
- MAP2K4 (5)
- NFKB1 (5)
- NR4A1 (5)
- NTRK1 (5)
- RAF1 (5)
- TRAF2 (5)
- AKT3 (4)
- ATF4 (4)
- FGF2 (4)
- FGF4 (4)
- IKBKB (4)
- MAP3K7 (4)
- MAPK1 (4)
- MAPKAPK2 (4)
- MAPT (4)
- MEF2C (4)
- NFKB2 (4)
- NGF (4)
- NTRK2 (4)
- PAK2 (4)
- PDGFB (4)
- RPS6KA1 (4)
- TAB2 (4)
- TNFRSF1A (4)
- ACVR1B (3)
- ACVR1C (3)
- AKT2 (3)
- CDC25B (3)
- DUSP1 (3)
- DUSP6 (3)
- EGF (3)
- FGF1 (3)
- FGF7 (3)
- FGFR1 (3)
- HSPA8 (3)
- IL1R1 (3)
- MAP2K2 (3)
- MAP3K4 (3)
- MAP3K5 (3)
- MAP3K8 (3)
- MAPK8 (3)
- NFATC4 (3)
- NRAS (3)
- PDGFA (3)
- PDGFRB (3)
- PPP3CA (3)
- SRF (3)
- TGFB1 (3)
- TGFBR1 (3)
- TGFBR2 (3)
- TRAF6 (3)
- CACNB1 (2)
- CHP1 (2)
- DUSP16 (2)
- DUSP4 (2)
- DUSP8 (2)
- FAS (2)
- FGF18 (2)
- GADD45A (2)
- GADD45B (2)
- GADD45G (2)
- GRB2 (2)
- HRAS (2)
- IL1A (2)
- IL1R2 (2)
- MAP2K1 (2)
- MAP3K11 (2)
- MAP3K12 (2)
- MAP3K14 (2)
- MAP3K6 (2)
- MAP4K1 (2)
- MAP4K3 (2)
- MAPK3 (2)
- MAPK7 (2)
Reactivities
- Human (521)
- Mouse (408)
- Rat (355)
- Bovine (18)
- Monkey (9)
- Pig (8)
- Rabbit (8)
- Chicken (7)
- Dog (7)
- Rhesus Monkey (6)
- X. tropicalis (5)
- Xenopus (5)
- Cow (4)
- Hamster (2)
- Sheep (2)
- Zebrafish (2)
- C. elegans (1)
- Canine (1)
- Carp (1)
- Drosophila (1)
- Feline (1)
- Gibbon (1)
- Gorilla (1)
- Guinea Pig (1)
- Horse (1)
- Macaque (1)
- Primate (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (495)
- Protein Kinase (226)
- Transcription Factors (132)
- ES Cell Differentiation/IPS (104)
- Transmembrane (99)
- Secreted Protein (79)
- Stem cell - Pluripotency (29)
- Adult stem cells (28)
- Phosphatase (27)
- Embryonic stem cells (22)
- Induced pluripotent stem cells (16)
- Protease (12)
- Stem cell relevant signaling - JAK/STAT signaling pathway (10)
- Cancer stem cells (8)
- Ion Channels: Calcium (7)
- Stem cell relevant signaling - Wnt Signaling pathway (6)
- Ion Channels: Other (5)
- Nuclear Hormone Receptor (5)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (2)