Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit Polyclonal Anti-STK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal Anti-ARRB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Applications
- IHC
Pathways
- MAPK signaling pathway
Filter by
Target Symbol
- MAP2K1 (173)
- MAP2K3 (95)
- AKT1 (64)
- JUN (63)
- MEF2C (52)
- PPP5C (51)
- FOS (40)
- GADD45G (37)
- EGFR (33)
- HSPA1A (32)
- MAP2K4 (30)
- MAPK1 (29)
- BRAF (28)
- MAPK9 (27)
- HRAS (26)
- MAPT (21)
- RASGRP3 (20)
- MAP2K2 (18)
- FGFR2 (17)
- MYC (17)
- MAPK13 (16)
- NTF3 (16)
- TP53 (16)
- CHP1 (15)
- PDGFRA (15)
- CASP3 (14)
- MAPK8 (13)
- STK3 (12)
- PTPN7 (11)
- RELA (11)
- ATF2 (10)
- DDIT3 (10)
- AKT2 (9)
- AKT3 (9)
- IKBKG (9)
- NTRK1 (9)
- NTRK2 (9)
- FGFR3 (8)
- HSPA8 (8)
- MAP3K8 (8)
- PAK1 (8)
- PDGFRB (8)
- STMN1 (8)
- TGFBR2 (8)
- BDNF (7)
- CHUK (7)
- FGF2 (7)
- MAPK3 (7)
- NTF4 (7)
- DUSP10 (6)
- JUND (6)
- MAPK12 (6)
- MAPK14 (6)
- MAPK8IP1 (6)
- NRAS (6)
- PPP3CA (6)
- PRKCA (6)
- FGF13 (5)
- PPM1B (5)
- RAF1 (5)
- RPS6KA1 (5)
- TRAF2 (5)
- ARRB1 (4)
- MAPKAPK2 (4)
- PAK2 (4)
- TRAF6 (4)
- ACVR1C (3)
- DUSP1 (3)
- DUSP6 (3)
- ELK1 (3)
- GRB2 (3)
- IKBKB (3)
- MAP3K14 (3)
- MAP3K4 (3)
- MAP3K7 (3)
- NFKB1 (3)
- NFKB2 (3)
- SRF (3)
- TGFB1 (3)
- TGFBR1 (3)
- TNF (3)
- ACVR1B (2)
- ARRB2 (2)
- DUSP16 (2)
- DUSP4 (2)
- DUSP8 (2)
- EGF (2)
- FGF1 (2)
- FGF7 (2)
- FGFR1 (2)
- GADD45A (2)
- GADD45B (2)
- HSPB1 (2)
- IL1B (2)
- IL1R1 (2)
- LAMTOR3 (2)
- MAP2K6 (2)
- MAP3K11 (2)
- MAP3K12 (2)
- MAP3K5 (2)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1249)
- Protein Kinase (762)
- Transcription Factors (419)
- ES Cell Differentiation/IPS (286)
- Transmembrane (146)
- Secreted Protein (122)
- Stem cell - Pluripotency (56)
- Stem cell relevant signaling - JAK/STAT signaling pathway (50)
- Phosphatase (47)
- Adult stem cells (46)
- Cancer stem cells (33)
- Embryonic stem cells (30)
- Induced pluripotent stem cells (27)
- Stem cell relevant signaling - Wnt Signaling pathway (18)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (17)
- Protease (14)
- Ion Channels: Calcium (4)
- Ion Channels: Other (4)
- Nuclear Hormone Receptor (2)