Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Progesterone Receptor (PGR) mouse monoclonal antibody, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit Polyclonal antibody to Mad2L1 (MAD2 mitotic arrest deficient-like 1 (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 205 of MAD2L1 (Uniprot ID#Q13257) |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
CDC25A Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25A |
Anti-Human IGF-I Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IGF-I |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
USD 475.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone D3E7 (5B6/6), Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Active filters
Category
- Antibodies
Applications
- IHC
Pathways
- Progesterone-mediated oocyte maturation
Filter by
Target Symbol
- MAP2K1 (183)
- PGR (104)
- AKT1 (73)
- PIK3CG (54)
- PDE4A (51)
- PIK3R5 (37)
- BRAF (30)
- MAPK1 (29)
- MAPK9 (28)
- PIK3CD (28)
- PLK1 (27)
- MAPK8 (26)
- ANAPC11 (25)
- PIK3CA (23)
- PDE4B (21)
- MAPK13 (19)
- IGF1 (16)
- AKT2 (13)
- MAPK14 (13)
- CCNB1 (12)
- AKT3 (11)
- ARAF (11)
- HSP90AA1 (11)
- HSP90AB1 (11)
- PDE2A (11)
- RAF1 (11)
- PDE10A (10)
- INS (9)
- PIK3R1 (9)
- CDK1 (8)
- MAPK3 (8)
- CDC25A (7)
- PDE1B (7)
- PKMYT1 (7)
- RPS6KA1 (7)
- ANAPC1 (6)
- ANAPC2 (6)
- CDC16 (6)
- MAPK12 (6)
- PDE1A (6)
- PDE4D (6)
- CCNA1 (5)
- IGF1R (5)
- PDE6G (5)
- PDE9A (5)
- CDC27 (4)
- MAD2L1 (4)
- ADCY1 (3)
- ADCY5 (3)
- ANAPC10 (3)
- ANAPC4 (3)
- ANAPC5 (3)
- CDC25B (3)
- CDC25C (3)
- GNAI1 (3)
- PDE3A (3)
- PDE7B (3)
- RPS6KA6 (3)
- SKP2 (3)
- ADCY4 (2)
- ANAPC7 (2)
- BUB1 (2)
- CCNB2 (2)
- CDK2 (2)
- PDE5A (2)
- PDE8B (2)
- PIK3R3 (2)
- PRKACA (2)
- PRKACG (2)
- PRKX (2)
- RPS6KA2 (2)
- RPS6KA3 (2)
- ADCY3 (1)
- ADCY6 (1)
- ADCY7 (1)
- ADCY8 (1)
- ANAPC13 (1)
- CCNA2 (1)
- CDC2 (1)
- CDC23 (1)
- FZR1 (1)
- GNAI3 (1)
- MAD2L2 (1)
- MAPK10 (1)
- MAPK11 (1)
- PDE11A (1)
- PDE1C (1)
- PDE4C (1)
- PDE6D (1)
- PDE7A (1)
- PDE8A (1)
- PIK3CB (1)
- PIK3R2 (1)
- PRKACB (1)
Reactivities
- Human (972)
- Rat (793)
- Mouse (779)
- Dog (274)
- Monkey (265)
- Bovine (19)
- Chicken (9)
- Pig (7)
- Rabbit (7)
- Primate (4)
- Cow (3)
- Gibbon (3)
- Gorilla (3)
- Horse (3)
- Xenopus (3)
- Zebrafish (3)
- Bat (2)
- Hamster (2)
- Porcine (2)
- Canine (1)
- Chimpanzee (1)
- Drosophila (1)
- Fungi (1)
- Insect (1)
- Orang-Utan (1)
- Plant (1)
- Rhesus Monkey (1)