Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-BTBD14B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the C terminal of human BTBD14B. Synthetic peptide located within the following region: WMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAE |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal KLF6 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 159-186 amino acids from the C-terminal region of human KLF6. |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
USD 515.00
In Stock
Rabbit polyclonal RUNX1 Antibody (S276)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RUNX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from human RUNX1. |
Rabbit polyclonal KLF5 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-SOX7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the middle region of human SOX7. Synthetic peptide located within the following region: LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLIS |
Rabbit Polyclonal Anti-HBZ Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HBZ antibody: synthetic peptide directed towards the N terminal of human HBZ. Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA |
Rabbit Polyclonal CCR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit Polyclonal GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3. |
Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal SOX4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 86-114 amino acids from the N-terminal region of human SOX4. |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- IHC
Isotypes
- IgG
Families
- ES Cell Differentiation/IPS
Filter by
Target Symbol
- AKT1 (21)
- CASP3 (12)
- JUN (10)
- BCL2 (8)
- EGFR (8)
- GCG (8)
- MKI67 (8)
- SMAD3 (8)
- STAT5B (8)
- BDNF (7)
- STAT6 (7)
- BCL2L1 (6)
- CDH1 (6)
- CXCR4 (6)
- G6PC1 (6)
- GAPDH (6)
- GATA3 (6)
- KDR (6)
- NOTCH1 (6)
- SOX2 (6)
- SRC (6)
- CD70 (5)
- NES (5)
- PRKCA (5)
- SMAD1 (5)
- TTR (5)
- ACTB (4)
- ALDH1A1 (4)
- BSG (4)
- CD44 (4)
- CDH5 (4)
- CTNNB1 (4)
- CXCL12 (4)
- DLX5 (4)
- FOXA2 (4)
- HCRTR1 (4)
- HNF1A (4)
- JMJD6 (4)
- KLF4 (4)
- MAP2 (4)
- MYB (4)
- PAX3 (4)
- PROM1 (4)
- SLC2A1 (4)
- SOX4 (4)
- TCF3 (4)
- VIM (4)
- WNT3A (4)
- ACTN1 (3)
- AKT2 (3)
- AKT3 (3)
- ANGPT1 (3)
- ANPEP (3)
- AXIN2 (3)
- BGLAP (3)
- CDX2 (3)
- CEBPA (3)
- CSNK1A1 (3)
- CSNK2A1 (3)
- CYP3A4 (3)
- EGF (3)
- FGF4 (3)
- FGF7 (3)
- FLT3 (3)
- GATA1 (3)
- GATA6 (3)
- GFAP (3)
- HNF1B (3)
- HNF4A (3)
- ICAM1 (3)
- ID4 (3)
- IGF1 (3)
- IRF6 (3)
- JAG1 (3)
- KIT (3)
- LAMP1 (3)
- LMX1A (3)
- MAPK8 (3)
- PDGFRB (3)
- PECAM1 (3)
- SERPINA1 (3)
- SFRP1 (3)
- SHH (3)
- SIPA1 (3)
- SMAD5 (3)
- STAT5A (3)
- TFRC (3)
- TGFB1 (3)
- WNT1 (3)
- YBX1 (3)
- ALCAM (2)
- APH1A (2)
- AXIN1 (2)
- BMP15 (2)
- BMP7 (2)
- CCR5 (2)
- CD38 (2)
- CD81 (2)
- CD8A (2)
- CD9 (2)
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Pathways in cancer (209)
- Focal adhesion (118)
- Colorectal cancer (106)
- MAPK signaling pathway (99)
- ErbB signaling pathway (80)
- Cytokine-cytokine receptor interaction (77)
- Wnt signaling pathway (75)
- Jak-STAT signaling pathway (71)
- Melanoma (68)
- Prostate cancer (67)
- Pancreatic cancer (65)
- Chronic myeloid leukemia (61)
- Neurotrophin signaling pathway (61)
- Endometrial cancer (60)
- Acute myeloid leukemia (58)
- Apoptosis (57)
- Regulation of actin cytoskeleton (56)
- Glioma (54)
- Small cell lung cancer (54)
- Tight junction (52)
- Chemokine signaling pathway (51)
- Leukocyte transendothelial migration (50)
- Renal cell carcinoma (50)
- Adherens junction (49)
- T cell receptor signaling pathway (49)
- VEGF signaling pathway (48)
- Non-small cell lung cancer (47)
- Toll-like receptor signaling pathway (47)
- Insulin signaling pathway (46)
- B cell receptor signaling pathway (45)
- Cell adhesion molecules (CAMs) (45)
- Hematopoietic cell lineage (45)
- Adipocytokine signaling pathway (44)
- Basal cell carcinoma (43)
- Endocytosis (43)
- Fc epsilon RI signaling pathway (42)
- Epithelial cell signaling in Helicobacter pylori infection (41)
- Fc gamma R-mediated phagocytosis (41)
- Progesterone-mediated oocyte maturation (41)
- Melanogenesis (39)
- TGF-beta signaling pathway (39)
- GnRH signaling pathway (37)
- mTOR signaling pathway (36)
- Hedgehog signaling pathway (35)
- Natural killer cell mediated cytotoxicity (34)
- Metabolic pathways (32)
- Gap junction (31)
- Amyotrophic lateral sclerosis (ALS) (27)
- Alzheimer's disease (24)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (24)
- Pathogenic Escherichia coli infection (24)
- Viral myocarditis (23)
- Maturity onset diabetes of the young (22)
- Huntington's disease (21)
- Hypertrophic cardiomyopathy (HCM) (21)
- Dilated cardiomyopathy (20)
- ECM-receptor interaction (20)
- Bladder cancer (19)
- Calcium signaling pathway (19)
- Notch signaling pathway (19)
- p53 signaling pathway (17)
- Dorso-ventral axis formation (16)
- Axon guidance (15)
- Thyroid cancer (15)
- Glycolysis / Gluconeogenesis (14)
- Type II diabetes mellitus (14)
- Cell cycle (12)
- Parkinson's disease (12)
- Prion diseases (11)
- Long-term depression (10)
- Vibrio cholerae infection (9)
- Neuroactive ligand-receptor interaction (8)
- Autoimmune thyroid disease (7)
- Galactose metabolism (7)
- Long-term potentiation (7)
- NOD-like receptor signaling pathway (7)
- Oocyte meiosis (7)
- Phosphatidylinositol signaling system (7)
- RIG-I-like receptor signaling pathway (7)
- Retinol metabolism (7)
- Starch and sucrose metabolism (7)
- Systemic lupus erythematosus (7)
- Vascular smooth muscle contraction (7)
- Renin-angiotensin system (6)
- Type I diabetes mellitus (6)
- Allograft rejection (5)
- Antigen processing and presentation (5)
- Complement and coagulation cascades (5)
- Lysosome (5)
- Graft-versus-host disease (4)
- Nicotinate and nicotinamide metabolism (4)
- Primary immunodeficiency (4)
- Drug metabolism - cytochrome P450 (3)
- Drug metabolism - other enzymes (3)
- Glutathione metabolism (3)
- Linoleic acid metabolism (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- ABC transporters (2)
- Inositol phosphate metabolism (2)
- PPAR signaling pathway (2)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- Regulation of autophagy (2)
- Tyrosine metabolism (2)
- Ubiquitin mediated proteolysis (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Asthma (1)
- Cardiac muscle contraction (1)
- Citrate cycle (TCA cycle) (1)
- Cysteine and methionine metabolism (1)
- Fructose and mannose metabolism (1)
- Oxidative phosphorylation (1)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Primary bile acid biosynthesis (1)
- Pyruvate metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)